SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085314 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085314
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.31e-34
Family Ribosomal proteins L24p and L21e 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085314   Gene: FBgn0032987   Transcript: FBtr0085961
Sequence length 159
Comment type=protein; loc=2L:complement(22247226..22247705); ID=FBpp0085314; name=RpL21-PA; parent=FBgn0032987,FBtr0085961; dbxref=GB_protein:AAF57259.1,FlyBase:FBpp0085314,FlyBase_Annotation_IDs:CG12775-PA,REFSEQ:NP_610144,GB_protein:AAF57259,FlyMine:FBpp0085314,modMine:FBpp0085314; MD5=b2e4b76ae2c566ebe381be45fdd2f9a9; length=159; release=r5.30; species=Dmel;
Sequence
MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGK
TGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAK
EKGQWVSLKRQPEQPKKAHFVKKLEEPIALAPIPYEFIA
Download sequence
Identical sequences B3NKM6 B4ILL7 B4Q4X0 Q9V9M7
4v6w_CT NP_001260689.1.81976 NP_001286133.1.81976 NP_610144.1.81976 XP_001973930.1.56816 XP_002044627.1.34323 XP_016025844.1.80810 XP_016969667.1.97277 FBpp0200272 7227.FBpp0085314 FBpp0085314 FBpp0303728 FR70 FBpp0222754 FBpp0085314 FBpp0085314 FBpp0139915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]