SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085324 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085324
Domain Number 1 Region: 169-438
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.73e-65
Family Transglutaminase core 0.00000265
Further Details:      
 
Domain Number 2 Region: 469-637
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-43
Family Extended PAW domain 0.0000922
Further Details:      
 
Domain Number 3 Region: 36-128
Classification Level Classification E-value
Superfamily PUG domain-like 8.11e-21
Family PUG domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085324   Gene: FBgn0033050   Transcript: FBtr0085971
Sequence length 638
Comment type=protein; loc=2R:join(1904909..1904911,1905320..1905713,1905769..1905860,1905923..1906758,1906814..1906898,1906958..1907054,1907111..1907520); ID=FBpp0085324; name=Pngl-PB; parent=FBgn0033050,FBtr0085971; dbxref=FlyBase:FBpp0085324,FlyBase_Annotation_IDs:CG7865-PB,GB_protein:AAM68339.2,REFSEQ:NP_724444,GB_protein:AAM68339,FlyMine:FBpp0085324,modMine:FBpp0085324; MD5=e159fdf19191c7650311d3f834262c06; length=638; release=r5.30; species=Dmel;
Sequence
MWQLVINMVDINLECVHQIEPKTRSAGQQQQERGLKEAYLEAVRILLVLLENILAQPENS
MFRTIRQENKAIKEKLLSLPGCERLLEAIGFVRAPSSNAYTLPTEVSLQQVKKYRDALSE
RRTAWLNGTVSKSPPQQSTTSTTPLFIKPSVEYRHRIAFPRVLRTNNNFLQSLELYSDAV
MQYEDNLLLATGRTLIPVEELTEMASEKLIDIQDQIASGERQEKEPCVRDLLLVELVNWF
NTQFFQWVNNIPCRVCGSEESRLRRTEREGDIRVEVTVCCGQESKFYRYNDISQLLVSRK
GRCGEYANCFTFLCRALDYDARIVHSHFDHVWTEVYSEAQMRWLHVDPSENVIDSPLMYQ
HGWKRHIDYILAYSRDDIQDVTWRYTNDHQKILHLRKLCGEKEMVQTLDAIRAKRRQNCT
ADRKLFLSQRNMYEVIGLTLERKPTENELKGRSSGSLSWRQSRGEHTFTNIFVFNLSATE
LQKRQLNVRYSCATDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLA
RLEDTDCGEIAWTFDFSKTNLKVKSYNLVFETKTFGDGKISVTVDATDGSASVENATGFK
IVAKLTGGKGDVAWQHTQLFRQSLNSRDYPFDLQVQLH
Download sequence
Identical sequences FBpp0085324 FBpp0085325 7227.FBpp0085324 FBpp0085324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]