SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085325 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085325
Domain Number 1 Region: 162-431
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.59e-65
Family Transglutaminase core 0.00000265
Further Details:      
 
Domain Number 2 Region: 462-630
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-43
Family Extended PAW domain 0.0000922
Further Details:      
 
Domain Number 3 Region: 29-121
Classification Level Classification E-value
Superfamily PUG domain-like 8.11e-21
Family PUG domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085325   Gene: FBgn0033050   Transcript: FBtr0085972
Sequence length 631
Comment type=protein; loc=2R:join(1905338..1905713,1905769..1905860,1905923..1906758,1906814..1906898,1906958..1907054,1907111..1907520); ID=FBpp0085325; name=Pngl-PA; parent=FBgn0033050,FBtr0085972; dbxref=FlyBase:FBpp0085325,FlyBase_Annotation_IDs:CG7865-PA,GB_protein:AAF57293.2,REFSEQ:NP_610192,GB_protein:AAF57293,FlyMine:FBpp0085325,modMine:FBpp0085325; MD5=935c6dca8a02d67ea6f438efe418e5a7; length=631; release=r5.30; species=Dmel;
Sequence
MVDINLECVHQIEPKTRSAGQQQQERGLKEAYLEAVRILLVLLENILAQPENSMFRTIRQ
ENKAIKEKLLSLPGCERLLEAIGFVRAPSSNAYTLPTEVSLQQVKKYRDALSERRTAWLN
GTVSKSPPQQSTTSTTPLFIKPSVEYRHRIAFPRVLRTNNNFLQSLELYSDAVMQYEDNL
LLATGRTLIPVEELTEMASEKLIDIQDQIASGERQEKEPCVRDLLLVELVNWFNTQFFQW
VNNIPCRVCGSEESRLRRTEREGDIRVEVTVCCGQESKFYRYNDISQLLVSRKGRCGEYA
NCFTFLCRALDYDARIVHSHFDHVWTEVYSEAQMRWLHVDPSENVIDSPLMYQHGWKRHI
DYILAYSRDDIQDVTWRYTNDHQKILHLRKLCGEKEMVQTLDAIRAKRRQNCTADRKLFL
SQRNMYEVIGLTLERKPTENELKGRSSGSLSWRQSRGEHTFTNIFVFNLSATELQKRQLN
VRYSCATDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLARLEDTDC
GEIAWTFDFSKTNLKVKSYNLVFETKTFGDGKISVTVDATDGSASVENATGFKIVAKLTG
GKGDVAWQHTQLFRQSLNSRDYPFDLQVQLH
Download sequence
Identical sequences Q7KRR5
FBpp0085325 FBpp0085325 NP_610192.1.81976 NP_724444.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]