SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085442 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085442
Domain Number 1 Region: 48-162
Classification Level Classification E-value
Superfamily ARID-like 6.15e-29
Family ARID domain 0.0011
Further Details:      
 
Domain Number 2 Region: 383-549
Classification Level Classification E-value
Superfamily ARM repeat 0.00000259
Family Clathrin adaptor core protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085442   Gene: FBgn0042085   Transcript: FBtr0086107
Sequence length 1688
Comment type=protein; loc=2R:join(2524194..2524435,2524500..2525515,2525686..2528492,2528790..2529791); ID=FBpp0085442; name=Bap170-PA; parent=FBgn0042085,FBtr0086107; dbxref=FlyBase:FBpp0085442,FlyBase_Annotation_IDs:CG3274-PA,GB_protein:AAF57363.1,REFSEQ:NP_610216,GB_protein:AAF57363,FlyMine:FBpp0085442,modMine:FBpp0085442; MD5=18c218fb7c831741d2237baf9469f7ef; length=1688; release=r5.30; species=Dmel;
Sequence
MSATTIDNVRVLLQSLPAAAVNSATQPGDLQTPGKIAAPATPLRAKNPAQLQIMPEKVEE
MPPSPPEEFWRDLQQFHERRGTPLTQPARISGKHVDLYKLYNEVTERGGFNKVTMRDEWD
EVYSAMETLRERCVNGTASIKHIYRRYLDKYERLNFFGEDPDKMEALEAAIEIVEMGGGR
SRSRFLAGAGGGLGSIFGSAHSTLPAVPMAYNQRQHSVNVERRRQYKMSTQLHRHSSYEK
LLLSLLSPLPNEQDFAINVCTLMANEARHTLQLSECPKLLDVLLAHLGVYADFTMRQLFQ
HSYTEVRHHSQLSFWRDLLHDKPQVLELYTDEQAWLDNGLISKEDGENSAARSELLAACD
ELHFLNLRRSNGTDERMGQRVLQIVQLVRTLSFHQENHALLASNRTLWRYLVMGANVRWS
NIHIQALETAGNLAQQFELLDPTTDELSRNLLATLCEGIDSNDRAVIMSCLEILYKLCGR
EGNSQHINRCLGLDFYQRAMLLLSLTDVMMIIFTLEAVYALSALGARPCSMLMQVRGLID
QLVTLITVEAQSYGTGGCILMRVVEVFPGNMAASLAQNMPAILAPGPTSLTTLPTSLQVA
VKPPAVLPTPTPAQTQVLPHGEQTPLVTALPGLPMPSLPQVQLPVPSLPQVQLPPIAATV
TLPSLPSASQSFTHEDEQYALAWLGATYERAGNGNDLRVEQAELYRIYLSHCQKAGKLSV
VNHMQFPRLVRLIFNQSVGPVIVRHLDGIELPGTYYVGIRMRAQPLAMQQRPTPSIVPVK
KDTPILPKQPFSDPVQTEVASEESVSSAVTPPPSSSLIKSLLANKVTERQQKQKAQAQTP
QPPALVATTASGTNATQPIKVTSTAISAFVNNPLMQHTPVKVGQTTIKPLHPQMAIEKKP
ITDSAPPPLAPLSGANVVTKDASGRTLIIASAAAKRKLTIDEEQNKRLALDAAASSSSSS
SSGGKEEAQVTPSKNAANLYADLAASILEDEDMDDVPPLAKPSQEQSQQHPQQAQQLQLI
PAKVQPTQRQLVFPGSNVVSPAPHSQLKLATTATIKTDQGLQTVPVILQPKTAMDSTPAP
QTQYVLATNQQGQTYLVAQQPTIPTSTQSAPPTLLVTQTPQQQTKTIIILQQPGGVSAAN
VAGTQKMIMTTAQGQQVLVTTTTAPQLAQPRTSTPQQQIFIAPQRPVPALGAGQMSPSLL
SQLNQIPATIKLHQPQPQPQLVSPQLAPQQRLVAAKPGASLPIPQLQQHQSIIQQHIISG
PSTPTSTVGGTVGGEKRQVILGGIKETTLITQTSATPAPLQQSQLNSQTIITQSPTSTAI
VGGVALQQQHHIRSVLDQQQQHHPSIIQQKITMPAISEATKPKIAPVPVSPTVTLLAKKP
APPQPAQVSSPKPSVTQAVVVTTSGTSDSTEGGKTVVLATSEAKPAESEVVAQTVVPPAV
VTTGPSSSSLVVSQSVYAASGPNANPTPSPMPVDANWLYICDWRNCPRKKFKSLNELQYH
VCSVHCPDHLDSDADIYCQWGSGPNFCDNRARKRYSLMTHLIDRHLTTENLRASVQRRLA
TGIHNVAPTQAPVTIVRNEGHAQRLAGGATGSPSGPASAVPVVGSAAMQAMNRHTTDYTN
AKELMDENEGPVTKSIRLTAALIIRNLVTYSATAKRSLKRYESRLANVAFSNVEASGVLS
HIMYELSQ
Download sequence
Identical sequences A1Z6M0
FBpp0085442 FBpp0085442 NP_610216.1.81976 7227.FBpp0085442 FBpp0085442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]