SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085558 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085558
Domain Number 1 Region: 56-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.01e-46
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 536-646
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000483
Family Ankyrin repeat 0.0043
Further Details:      
 
Weak hits

Sequence:  FBpp0085558
Domain Number - Region: 324-343,389-435
Classification Level Classification E-value
Superfamily TPR-like 0.0114
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085558   Gene: FBgn0034542   Transcript: FBtr0086245
Sequence length 702
Comment type=protein; loc=2R:complement(16550437..16550600,16550665..16550891,16550958..16551373,16551440..16552182,16552291..16552573,16554424..16554699); ID=FBpp0085558; name=Fem-1-PA; parent=FBgn0034542,FBtr0086245; dbxref=FlyBase:FBpp0085558,FlyBase_Annotation_IDs:CG9025-PA,GB_protein:AAF57431.2,REFSEQ:NP_611508,GB_protein:AAF57431,FlyMine:FBpp0085558,modMine:FBpp0085558; MD5=468c24355d46915f0f13f07e3a908fc8; length=702; release=r5.30; species=Dmel;
Sequence
MDVDPAEEAPLDEAHTSIYDGYPPDFGYFNMAHGMLVEISEEIRAKFPHEPRLRFSQLNN
LHLAARSGQMLSFVEILNSVSCRAVQTHLVNTNFDQPDGQSLTPLTMAAMMGNVKFVKTL
LSHYDVDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPL
RAACYEGRLDIVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQAL
CGATALHYAAESGHLDVVVALLDHGATLKKNELGITPALQAAERLHEDVLEAFIERPELM
SLEEQITALELLGATYANDKIKYDVNKAYGYLLRAMQLRYSNPRGVIRKRVQPTVPAYDN
WLETENLPELYAIKLNHHSIHMESLAIRERILGRNNPELPQAIIYRGAVMADQGRFYQCQ
VLWNYAIDLRMRNNVSVDRDLLRFAQLFAQILRVENHNLTLDHVLPVLAKCQQEIENNKF
KIKEAKPNACPSLWQDQNNQNCITALYLIKIVTHLARRKKDQNIDEEHIQQLFLVVRKFI
QNDTRLQDGQTLLHIAVNGVMPVDEFYTNEMCRFPCYATALVLVHCGASVVAVDSDRNTP
LHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQTAATACKLPILANRLHAHQN
AHTSLKCLAARSIATNRLNFKGLIPTQLEAFIQMHSVRKVLP
Download sequence
Identical sequences H1UUF6
7227.FBpp0085558 FBpp0085559 FBpp0085558 FBpp0085558 NP_611508.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]