SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085716 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085716
Domain Number 1 Region: 504-564
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.24e-17
Family SPT5 KOW domain-like 0.0004
Further Details:      
 
Weak hits

Sequence:  FBpp0085716
Domain Number - Region: 632-663
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00602
Family Ribosomal proteins L24p and L21e 0.082
Further Details:      
 
Domain Number - Region: 292-350
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0381
Family Ribosomal proteins L24p and L21e 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085716   Gene: FBgn0040273   Transcript: FBtr0086531
Sequence length 1078
Comment type=protein; loc=2R:join(15325477..15325848,15325912..15326036,15326095..15326232,15326290..15326740,15326803..15326873,15326931..15327097,15327158..15327330,15327386..15327639,15327699..15327894,15327949..15328672,15328731..15329296); ID=FBpp0085716; name=Spt5-PA; parent=FBgn0040273,FBtr0086531; dbxref=FlyBase:FBpp0085716,FlyBase_Annotation_IDs:CG7626-PA,GB_protein:AAF57561.1,REFSEQ:NP_652610,GB_protein:AAF57561,FlyMine:FBpp0085716,modMine:FBpp0085716; MD5=6fe891ab92c5983b588e358fa8efb4da; length=1078; release=r5.30; species=Dmel;
Sequence
MSDSEVSNMSDSGSEDGSISNKSQRSARSKSRSRSRSGSRGSRSVSRSRSRSQSGHSRSG
SESPQRRDNRGKSDESGEEEEEPPGEDIDSEEYDEEENDDHPRKKKKKERFGGFIIDEAE
VDDEVDEDDEWEEGANEIGIVGNEIDELGPTARDIEIRRRGTNLWDTQKEDEIEEYLRKK
YADESIAKRHFGDGGEEMSDEITQQTLLPGIKDPNLWMVKCRIGEEKATALLLMRKYLTY
LNTDDPLQIKSIIAPEGVKGYIYLEAYKQTHVKTCIDNVGNLRMGKWKQEMVPIKEMTDV
LKVVKEQVGLKVKQWVRLKRGLYKDDIAQVDYVDLAQNQVHLKLLPRIDYTRMRGALRTT
ATESDDSKRKKKRRPAAKPFDPEAVRAIGGEVHSDGDFLLFEGNRYSRKGFLYKNFTMSA
ILSDGVKPTLAELERFEESPEEVNLEIMGTVKDDPTMAHSFSMGDNVEVCVGDLENLQAK
IVAIDGTMITVMPKHQDLKDPLIFKASELRKYFKTGDHARVLAGRYEGETGLIIRVEPTR
VVLVSDLTNHELEVLPRDLQLCSDVATGVDCLGQFQWGDMVQLDSQNVGVIVRLERENFH
VLGMNGKCIECKPTALHKRKENRHTVALDADQNQIRRRDVVKVMEGPHAGRSGEIKHLYR
SLAFLHCRMYTENGGIFVCKTRHLQLAGGSKTTVSNAGIVGGLGFMSPRIQSPMHPSGGR
GARGGARGGRGGFRVTRDREILGKTIKISGGPYKGAVGIVKDATESTARVELHTSCQTIS
VDRNHIAIVGVTGKEGSVSTYGRTPARTPGYGAQTPSYTAAGSKTPLVGSQTPNWDTDTR
TPYGTMTPSHDGSMTPRHGAWDPTANTTPARNNDFDYSLEEPSPSPGYNPSTPGYQMTSQ
FAPQTPGTLYGSDRSYSPFNPSPSPAPSPYPVGYMNTPSPSTYSPNTPGGIPQSPYNPQT
PGASLDSSMGDWCTTDIEVRIHTHDDTDLVGQTGIIRTVSNGVCSVFLRQEDRSVSIVSE
HLAPVLPCNGDEFKIIYGDDRESVGRVLSKDGDVFVCRINEEIKLLPINFLCKMKSID
Download sequence
Identical sequences Q9V460
FBpp0085716 FBpp0085716 FBpp0085716 7227.FBpp0085716 NP_652610.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]