SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085813 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085813
Domain Number 1 Region: 406-602
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-55
Family Kelch motif 0.0000195
Further Details:      
 
Domain Number 2 Region: 49-167
Classification Level Classification E-value
Superfamily POZ domain 1.88e-33
Family BTB/POZ domain 0.0013
Further Details:      
 
Weak hits

Sequence:  FBpp0085813
Domain Number - Region: 330-444
Classification Level Classification E-value
Superfamily NHL repeat 0.000262
Family NHL repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085813   Gene: FBgn0034396   Transcript: FBtr0086631
Sequence length 617
Comment type=protein; loc=2R:complement(14710465..14710678,14710742..14712074,14712209..14712305,14713002..14713185,14713524..14713549); ID=FBpp0085813; name=CG15097-PB; parent=FBgn0034396,FBtr0086631; dbxref=FlyBase:FBpp0085813,FlyBase_Annotation_IDs:CG15097-PB,GB_protein:AAO41354.1,REFSEQ:NP_788412,GB_protein:AAO41354,FlyMine:FBpp0085813,modMine:FBpp0085813; MD5=4b07dd366935c076be0d3e9cbb06cb2e; length=617; release=r5.30; species=Dmel;
Sequence
MFLPVKSNHSGEASGNNEDVTTTSNNSTQTPSDLSPPGPNEEVLPQAHHQNPGHCIASFA
AINQMRNNAQLCDVRLEVGGDTINAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDS
SALRQLIDYTYTGEITITEQNVQVLLPASGLLQMHSVRDACCKFLLRQLHPSNCLGIRSF
ADAHSCKELHTRSHKYALQNFQQVVGTEEFLLLPFEEVRELISNSQLNISSEERVFAAVI
NWVKHDLPTRRLHIAELMSNVRLPLVSRDFLMSCVETETLMRDDSECKELLLEAMKYHLL
PEQRSIMGSQRTQERRPEGMKPYVFAVGGGSLFAIHNECEVYNPRSNSWSPVAPMLWRRS
RSGVTSLHKQLYVVGGYDGVSDLATAESYNPLTNKWSNITPMGTKRSCLGICSYDALIYV
CGGYDGASCLSSMERYDPLTGIWSSCPAMSTRRRYCRLAVLENCIYSLGGFDSTNYQSSV
ERFDPRVGRWQPVPSMSARRSSCGVASTDGHLYCIGGNDGTMCMSSGERFSLRRNSWEPI
AAMHSRRSTHEVVEVEGALFALGGNDGSSSLNSVERYDTRLNKWSVVNAMVARRSSVGAA
VLECFHLERGLVQTTNL
Download sequence
Identical sequences A0A0B4JD92
NP_001188973.1.81976 FBpp0292329 FBpp0085813 FBpp0292329 FBpp0085812 7227.FBpp0085813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]