SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085834 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085834
Domain Number 1 Region: 99-170
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.26e-19
Family Pointed domain 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085834   Gene: FBgn0023214   Transcript: FBtr0086652
Sequence length 177
Comment type=protein; loc=2R:complement(14555334..14555867); ID=FBpp0085834; name=edl-PA; parent=FBgn0023214,FBtr0086652; dbxref=FlyBase:FBpp0085834,FlyBase_Annotation_IDs:CG15085-PA,GB_protein:AAG22259.2,REFSEQ:NP_523786,GB_protein:AAG22259,FlyMine:FBpp0085834,modMine:FBpp0085834; MD5=8e5a5d900b01122de110b5b0aea2998d; length=177; release=r5.30; species=Dmel;
Sequence
MQVESSYTKYAGRVPPLDLTQVNGGQDLWGGNGGGNNASARRHLHHPYQMLDKCRGGVTL
ISASSAISSTSNSSDDNNNRLMSADDGTTSLLHPLGSDGLPLDPRDWTRADVWKWLINMA
VSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMALLS
Download sequence
Identical sequences Q7K119
FBpp0085834 FBpp0085834 FBpp0085834 7227.FBpp0085834 NP_523786.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]