SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085872 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085872
Domain Number 1 Region: 196-428
Classification Level Classification E-value
Superfamily Kelch motif 1.29e-33
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 439-536
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000196
Family Kelch motif 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085872   Gene: FBgn0261477   Transcript: FBtr0086693
Sequence length 609
Comment type=protein; loc=2R:join(14328979..14329818,14331160..14331717,14331858..14332289); ID=FBpp0085872; name=slim-PA; parent=FBgn0261477,FBtr0086693; dbxref=FlyBase:FBpp0085872,FlyBase_Annotation_IDs:CG5186-PA,GB_protein:AAF57686.1,REFSEQ:NP_523782,GB_protein:AAF57686,FlyMine:FBpp0085872,modMine:FBpp0085872; MD5=22fd1b7cd3b5345723dfcb2f337d3675; length=609; release=r5.30; species=Dmel;
Sequence
MNILNPGKFKCIVFDQLRHTWTFLLFICDFLAKIYRTPRITAHQEQLANHNNNNNNNNDL
IMEQDMPEEEVGQPEEALPQQDNGEVVDRFNAIQAAVELMDAASDLDEEEEEEDDDVDVD
VDYGDTDSESEFEEMYSDEWTSSSDELDEGTELSKSVLNVFLSSDKQQSQMAGQIPMYAF
QPLRLVKCQYRDKHIPGGFPLARSGHRIIASNSHLYSLGGYNPRSAMSASRHGRCLLFQE
LWSYNFATRTWRLELNAGNAANMPVELASNALTIHNNVLISHGGTGYPFGVSCSNDCYVY
RTASAGATPGVDRLQVKGDLPTAQYGPGIVIHKHFLYTIGGTTGFDYTCDVYRLDLRTGI
WENVYISRPEMRDDPEGRYRHEVVYDGKHIFVLGGGTSHSVYDLQRIPAYNLEANCWDYF
ETYPDQRAADADDGNRGYPKPRKCFSCVQHQSSTGDIEAFITGGLQGDFSTYFSDIWKLN
LRTKHWYRIETAILPRPLYFHSAAHSDNGCMYVFGGIEYIDKEMRRRNDLYKMWMTVPKL
SEMCWDAITYYNDNLDLYDRKTLLEAGIPKRFTERLPPQRRRRLDTSQPDPSMLISLYSN
PKRARSSTQ
Download sequence
Identical sequences A1ZB86
NP_523782.1.81976 NP_725794.2.81976 FBpp0085872 FBpp0085872 FBpp0304290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]