SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086102 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086102
Domain Number 1 Region: 2096-2159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.92e-18
Family PHD domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1293-1345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000424
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086102   Gene: FBgn0034240   Transcript: FBtr0086946
Sequence length 2171
Comment type=protein; loc=2R:join(13436592..13438896,13438949..13443159); ID=FBpp0086102; name=MESR4-PA; parent=FBgn0034240,FBtr0086946; dbxref=FlyBase:FBpp0086102,FlyBase_Annotation_IDs:CG4903-PA,GB_protein:AAF57837.2,REFSEQ:NP_523775,GB_protein:AAF57837,FlyMine:FBpp0086102,modMine:FBpp0086102; MD5=f4611767dc7efd8666a0c957076adf02; length=2171; release=r5.30; species=Dmel;
Sequence
MMEALDQQQAKLTSNRDDGEAGRGSETGSEEGTGAGAAAGEEDDIEELHYVLDQAKEENE
SHQHGQNNNAKGNEDGKPKKNDDVIDVTMANGQGFKDTPEEETTGTEETAETEETAETEE
AEQAEESLLNSRKSTDTPVDLGANCLTTGSPSKDLVKQELVEDKSEELKEPTSISLNEQF
LDDIELKTEVEDKSDSLSETHMEFLTDSEEQPSESLGANHESEIDEKVDHFQPKESDSNE
VEDKYFQSANEDSESEIEETVYTPPVINLETDSESGDKEFISIKDNESPVLEIEGGTEKS
QTSGDLYQADVGEYASTAPPEVDETTSQTIGVPSLEGSDTLDSPSLTMDVDLPCSEDGAP
PNVIKIESDMEDEAHSDSVKLKEHTVEVVPLIKLNGAHKALKEEKLEDGEVEEVEDPGEE
LEDPKEQSVITNHTGNNTKEEDTTASQVSALPLILPVGTTRSRSISSRSSTVSSASQPHL
VIDHPESEHNAKPPALKLSLKRRRSKSSSVSQPEKQTKVEAGGFVSSLLLQRLQSNSNVI
PPAISTESQQVLSCAKCNLQFDFERFQELNKHQAQCSGIQSANSSQLSQKQERFFRCSQC
CSVHQCWHFFLHMREVHRRYICLYCNHVYPSVEKLSLHLENKHDIDQSHFAKDAWDQQQS
KEDRARHLVCCTCQATFVQGSEFEDHDCSQLMQPCALCNQKGGHIIGCKNNKRKPTKRRR
KVRRPPEPPLPVSQEAVEQPVPVEAIPEQLPQQLHLQSDIQNPFPAENIPAPEPVEDPPA
PPIPKLVVPKIMLRVPKEFQKSVDAALSSTDTEDEELETAQPVEEAVSAPPEDLPFDAPP
PPPPALSYDDSTSSKLNRVLAELERTKLDIERTKADIITKKQSKIIMANAHLENVVPQVV
DPPQHLQPQQEEQRRWSLTPPASPHNNHVNLPEPPPALITEFQGQPDAVRRNSLGSDCMD
MDDSLNAPEMEGSRDFTEAQKETLEPAPPSQDTQTADEPLAIQPLPPADGIMVAGPDTHT
VDLQLDRPLDRFSMVDFVRLCLKSVYSLCLYCNHARRIAVNVKQLVIHLIGQHRFTATVD
SITAEELYAETIVAKLKSFLPNLENEYMNAASCCSLENGKYVEPFNERIYECFTCRFVTS
THKELYTHNRRLHIKSNITCVMCQTNFYSYSEILCHICPGEVAGSVYDLQFRCCLCDMAP
LPSAFRLMVHLRKQHQACDICLEDCQSQSKLSSHVWKHKLLHLCYRCGIAYRNKQDISKH
LFWKHGTESAGCKQCLQKRWRHVYHFCVPPAEFPCEQCGFVFSKAIYLEVHQRMHTGDFR
YACTEEGCEEKFVSRKLLLKHASSHVAKELPQAVSVEQTADAAPTEKLEDIKEELEEGED
EKEGAHNQEKLLSESLTNNETPKKEESDRIDNSIEPPLSKSENRKRRKKSKRNKESLEDL
NLIAPNLSESDSSDDSDSDAPRSSHQEQPKLPMRSSVDDLDMPKVMLSPSSESDADELDG
KSKLEDKEEKPLDGSTEEKALDADDELEPKKEEDQVDVSIWKNLLQNQAVAIPEEQAVKD
EEREDSLVNLPPAKLHVAWSDHDYCKLYRTPAPSPVKQKSANKSSIKTPGENASSDSDSS
SSSSSSDSDSSSCSCGSNCSCSSSNSSSSSGNSDDSDSSTARGSPQKRSRKKSLKVKKSS
ESLKIDQNGQNEQNQVEDTTAVNENNNPVAPPSPKPPMYNESDFDTAFSDTDEEFYDSHP
QKLANELLTQKREALMAEHAPMRPSNNYDIVENSRPSTPSLPEEASAFADKREKVRNKKK
KRERKSTCKSGKLQPVASTTPPPMDRIPGMPGMIAPLEPPTPILSHPESSLFPVTPLTHR
QLQSSMTRMSEGSSCSDADGQLKRSKRQRRPNKFYGYTSDDENMSAVLAPPLQVGMQLIK
PQPPPQLTWAKEDLPTPPKQRNRNNNNSSHHHHSHSNGGMAGSSRKRSKQRSLFGAGGSR
PAKRHKPDPNDHLPPIPTLKIRPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPAP
PPVLPTPLPVALPVPPPPPPAATAFNQPIPPALLPNPGFATLQYFKANNIRYPIRPPAGA
RLAREGESVYCYCRCPYDEVSEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAECRPKY
SEGIYQGAKPQ
Download sequence
Identical sequences A1ZAV3
FBpp0086102 NP_001097359.1.81976 NP_523775.2.81976 FBpp0086102 FBpp0112003 FBpp0086102 FBpp0112003 7227.FBpp0086102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]