SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086205 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086205
Domain Number 1 Region: 118-455
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.66e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 17-102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000364
Family Anticodon-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086205   Gene: FBgn0034177   Transcript: FBtr0087057
Sequence length 460
Comment type=protein; loc=2R:join(12889537..12889626,12889688..12889895,12889959..12891043); ID=FBpp0086205; name=CG6796-PA; parent=FBgn0034177,FBtr0087057; dbxref=FlyBase:FBpp0086205,FlyBase_Annotation_IDs:CG6796-PA,GB_protein:AAF57921.1,REFSEQ:NP_611176,GB_protein:AAF57921,FlyMine:FBpp0086205,modMine:FBpp0086205; MD5=1d51bf66ae98bcb955f00f643cfe0c1f; length=460; release=r5.30; species=Dmel;
Sequence
MLFLRRFYSKSGRIAQILKTNKPGDSLAIQGWIKNVRRLKNNTFLDINDGSTSSRFQVVV
PRTPENQHLAPGSVIAAVGKIQVAPNGSFELHANQVEMLAEGRLQEGYPFSPKQKHPPEY
VREHLHLRSRVDFVAAQMRVRHKAQKAIHDYMDDQDFVQINTPLLTTNDCEGAGEVFRVQ
PDSQDLLKQMNRPNIPMEQSYFDSKVFLSVSGQLHLEAMTYGLGKTYTLSPAFRAENSKS
PLHLAEFYMFEAELAHLEEMEKLAQFIEQMLKSVTNRLLETSGEDLSFCQRNSNSNSDLP
WLQVPWKIMSYDEALQVLQENKDSLKTPISLNEGFSKDQELFLVAHCGAPVFVVDWPAQQ
KPFYMKVSRSNPNRVHALDLLMPAVGELCGGSLRESDPAILKSHPHLPKDLEWYVDLRKY
GGVPTGGFGMGFERYLQLVTGVKNIRDVIPFPRYPHSCKM
Download sequence
Identical sequences Q7JZR5
7227.FBpp0086205 FBpp0086205 FBpp0086205 NP_611176.1.81976 FBpp0086205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]