The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0086223 |
Domain Number 1 |
Region: 2-233 |
Classification Level |
Classification |
E-value |
Superfamily |
PIN domain-like |
7.52e-71 |
Family |
5' to 3' exonuclease catalytic domain |
0.000000122 |
Further Details: |
|
|
Domain Number 2 |
Region: 220-351 |
Classification Level |
Classification |
E-value |
Superfamily |
5' to 3' exonuclease, C-terminal subdomain |
1.41e-40 |
Family |
5' to 3' exonuclease, C-terminal subdomain |
0.00000371 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Cellular Component |
IC (bits) |
H-Score |
Molecular Function |
IC (bits) |
H-Score |
Biological Process |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0086223 Gene: FBgn0025832 Transcript: FBtr0087075 |
Sequence length |
385 |
Comment |
type=protein; loc=2R:complement(12741624..12742699,12742762..12742843); ID=FBpp0086223; name=Fen1-PA; parent=FBgn0025832,FBtr0087075; dbxref=FlyBase:FBpp0086223,FlyBase_Annotation_IDs:CG8648-PA,GB_protein:AAF57944.1,REFSEQ:NP_523765,GB_protein:AAF57944,FlyMine:FBpp0086223,modMine:FBpp0086223; MD5=0090d12f4c3f34668c894284b5d7efc3; length=385; release=r5.30; species=Dmel; |
Sequence |
MGILGLSKLIADLAPQAIRESEMKHFFGRKVAIDASMCLYQFLIAVRSEGAQLATVNGDP
TSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALKAATDAGDD
AGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEAQCAALVKAGKVYATATEDM
DALTFGSTKLLRYLTYSEARKMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYCESIKG
IGPKRAIELINTYRDIETILDNLDSSKYTVPENWNYKVARELFIEPEVADADSIDLKWVE
PDEEGLVKFLCGDRQFNEERVRNGAKKLMKSKQAQTQVRLDSFFKTLPSTPNATNAAKRK
AEEAKKSANNKKAKTSGGGRGRRPK
|
Download sequence |
|
Identical sequences |
Q7K7A9
FBpp0086223 FBpp0086223 NP_523765.1.81976 7302871___KOG2519 7227.FBpp0086223 FBpp0086223 |