SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086223 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086223
Domain Number 1 Region: 2-233
Classification Level Classification E-value
Superfamily PIN domain-like 7.52e-71
Family 5' to 3' exonuclease catalytic domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 220-351
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.41e-40
Family 5' to 3' exonuclease, C-terminal subdomain 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086223   Gene: FBgn0025832   Transcript: FBtr0087075
Sequence length 385
Comment type=protein; loc=2R:complement(12741624..12742699,12742762..12742843); ID=FBpp0086223; name=Fen1-PA; parent=FBgn0025832,FBtr0087075; dbxref=FlyBase:FBpp0086223,FlyBase_Annotation_IDs:CG8648-PA,GB_protein:AAF57944.1,REFSEQ:NP_523765,GB_protein:AAF57944,FlyMine:FBpp0086223,modMine:FBpp0086223; MD5=0090d12f4c3f34668c894284b5d7efc3; length=385; release=r5.30; species=Dmel;
Sequence
MGILGLSKLIADLAPQAIRESEMKHFFGRKVAIDASMCLYQFLIAVRSEGAQLATVNGDP
TSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKRAERREEAEKALKAATDAGDD
AGIEKFNRRLVRVTKEHAKEAKELLTLMGVPYVDAPCEAEAQCAALVKAGKVYATATEDM
DALTFGSTKLLRYLTYSEARKMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYCESIKG
IGPKRAIELINTYRDIETILDNLDSSKYTVPENWNYKVARELFIEPEVADADSIDLKWVE
PDEEGLVKFLCGDRQFNEERVRNGAKKLMKSKQAQTQVRLDSFFKTLPSTPNATNAAKRK
AEEAKKSANNKKAKTSGGGRGRRPK
Download sequence
Identical sequences Q7K7A9
FBpp0086223 FBpp0086223 NP_523765.1.81976 7302871___KOG2519 7227.FBpp0086223 FBpp0086223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]