SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086569 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086569
Domain Number 1 Region: 20-85
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.94e-20
Family SCOPe 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086569   Gene: FBgn0050476   Transcript: FBtr0087439
Sequence length 106
Comment type=protein; loc=2R:join(10640095..10640247,10640451..10640618); ID=FBpp0086569; name=ave-PA; parent=FBgn0050476,FBtr0087439; dbxref=FlyBase:FBpp0086569,FlyBase_Annotation_IDs:CG30476-PA,GB_protein:AAM68548.1,REFSEQ:NP_725413,GB_protein:AAM68548,FlyMine:FBpp0086569,modMine:FBpp0086569; MD5=68a02bf616a08eeaf7f87aa207fc22f2; length=106; release=r5.30; species=Dmel;
Sequence
MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFAQHDITGRALL
RITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDMERLNIY
Download sequence
Identical sequences A0A1B2AIY1 B3NQT3 B4QFY1 Q8ML92
FBpp0139024 FBpp0086569 FBpp0086569 7227.FBpp0086569 NP_725413.1.81976 XP_001975593.1.56816 XP_002081541.1.80810 3bs5_A FBpp0209476 FBpp0086569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]