SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086578 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086578
Domain Number 1 Region: 62-189
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 8.58e-45
Family XPF/Rad1/Mus81 nuclease 0.0000108
Further Details:      
 
Domain Number 2 Region: 185-256
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.89e-16
Family Hef domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086578   Gene: FBgn0028434   Transcript: FBtr0087448
Sequence length 259
Comment type=protein; loc=2R:join(10740470..10741060,10741119..10741307); ID=FBpp0086578; name=Ercc1-PA; parent=FBgn0028434,FBtr0087448; dbxref=FlyBase:FBpp0086578,FlyBase_Annotation_IDs:CG10215-PA,GB_protein:AAF58196.1,REFSEQ:NP_477468,GB_protein:AAF58196,FlyMine:FBpp0086578,modMine:FBpp0086578; MD5=97a776a5de3db1120068bfb991301e13; length=259; release=r5.30; species=Dmel;
Sequence
MEDFDDDSFNDVLGAMEMPTAAKQPKVDAPAATAVNPAPSNSTEPSGSGRPAPGKPASNP
HCVLVHSKQRGNPILKSILNVPLEFRDDIVPDYVVGRTSCVLYLSLKYHNLNPDYICQRL
KALGKMYELRVLLVQVDTPEPNNALKSLTRISLLADLTMMLAWNAEEAGKIIETYKQFEK
RPPDLIMERVESNPHQKLLAALTNIKPVNKTDAAALLHTFGNLGNIINASEERLSQVMGL
GPRKAKKLYKTLQEPFLSK
Download sequence
Identical sequences Q7KMG7
NP_477468.1.81976 FBpp0086578 FBpp0086578 FBpp0086578 7227.FBpp0086578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]