SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086744 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086744
Domain Number 1 Region: 135-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.34e-82
Family Calponin-homology domain, CH-domain 0.00000235
Further Details:      
 
Domain Number 2 Region: 2895-3054
Classification Level Classification E-value
Superfamily Spectrin repeat 5.14e-27
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 3760-3919
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-27
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 3911-4032
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 379-496
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 4088-4249
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-24
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 4847-4922
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.96e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 8 Region: 3668-3809
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 2144-2293
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-22
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 2481-2614
Classification Level Classification E-value
Superfamily Spectrin repeat 9.24e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 3436-3589
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 3007-3156
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 4314-4435
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 786-907
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 1662-1807
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 16 Region: 3113-3262
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 17 Region: 4465-4578
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 3320-3447
Classification Level Classification E-value
Superfamily Spectrin repeat 2.5e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 19 Region: 4532-4654,4706-4736
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 20 Region: 697-828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000016
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 21 Region: 1862-1985
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000235
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 22 Region: 3588-3703
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000122
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 23 Region: 4756-4866
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000104
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 24 Region: 2674-2832
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000156
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 25 Region: 2408-2509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 26 Region: 2050-2184
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000216
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 27 Region: 1549-1658
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000118
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 28 Region: 1417-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 29 Region: 2263-2385
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 1343-1449
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000056
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 31 Region: 1194-1296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000681
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 32 Region: 635-729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000288
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 33 Region: 1035-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000331
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 34 Region: 467-594
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000461
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0086744
Domain Number - Region: 913-967
Classification Level Classification E-value
Superfamily SH3-domain 0.000131
Family SH3-domain 0.0033
Further Details:      
 
Domain Number - Region: 3270-3327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0259
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086744   Gene: FBgn0013733   Transcript: FBtr0087618
Sequence length 5201
Comment type=protein; loc=2R:complement(9752859..9753000,9753566..9753631,9753954..9754137,9754207..9754480,9755661..9755854,9757365..9757482,9757548..9757777,9757843..9757960,9758027..9758201,9758345..9758416,9758799..9758843,9759484..9759658,9759714..9761673,9761739..9761964,9762364..9769841,9769906..9770052,9788942..9789077,9789192..9789822,9790159..9791077,9791319..9791687,9791753..9792666,9792727..9793006,9804359..9804529,9804623..9804712,9805354..9805415,9809052..9809481); ID=FBpp0086744; name=shot-PE; parent=FBgn0013733,FBtr0087618; dbxref=FlyBase_Annotation_IDs:CG18076-PE,FlyBase:FBpp0086744,GB_protein:AAM68561,REFSEQ:NP_725337,FlyMine:FBpp0086744,modMine:FBpp0086744; MD5=e9fa9df352186eca9dae242f4a79365b; length=5201; release=r5.30; species=Dmel;
Sequence
MTSHSYYKDRLGFDPNEQQPGSNNSMKRSSSRQTTHHHQSYHHATTSSSQSPARISVSPG
GNNGTLEYQQVQREQRDRELYSNNGSLHHHQHHHHHHRHSTTGSASSPLYENSSSPAAPK
KAKHSSTQAQPQGGYEDALTQFKDERDAIQKKTFTKWVNKHLKKANRRVVDLFEDLRDGH
NLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRAEDIVDGNPKLTL
GLIWTIILHFQISDIVVGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSA
LVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYI
SSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERSFPPTLIEMKR
LLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVDVEAELRPDAIEKAWYRMNT
ALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAK
SIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKKVNKLHQRWAQLRTNFHTNL
VQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSD
LPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELALYQQRLNQLQKVYAELLST
STKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQLDLPSVHRYYENLMSELEK
REMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQF
FGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQDLREELNAFGETVATLQRRA
QTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSGRVKWRVRTAKGQEG
PIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQ
FLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREMDEVNRLFDEFEKRARAEEE
SKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEP
ELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHV
ISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQLGRMGVPTK
VLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGTTER
LSAMPTATSAYELDQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDELRNQIN
ALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDRVNDRT
VRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVS
DVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVSL
VSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPK
GVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPMEINQLELPIADLKNNY
QQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQI
REHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKFEKLYEKANK
RGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQL
APQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLA
YEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIG
AQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRR
SSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFL
ERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDTTKAQVKDILRRKSDVPGAE
QLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDSKERMLTVLGPISSD
PRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVEIKLKDILGKWD
DLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDTLPTDGDHQENLRKIENL
ERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLDTKKAETE
ASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREVMAREHE
VIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSE
TFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGLGETFLSS
CDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDR
LAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTS
EVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGRE
IKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGR
LDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDF
RNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERD
RRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLD
RQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAK
RFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDRLHDEILGKKPDFSDLADV
TAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALLAESRQGLRHLVLSYQDLVA
WMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISND
EAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAP
SEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVE
QIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSI
NDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILE
QALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPL
LDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSD
KLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDV
IAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKT
LKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPD
KPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHL
GAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVV
NRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLE
VELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQK
ASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY
NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLE
IALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREA
MLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFND
AWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTG
KNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDW
LKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGNNPE
VGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNA
PDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQR
WEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEK
LIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVFKGSRDQGLNARKGSRI
TPTRDTPDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHL
LYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTK
FDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLVMLCT
CRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAKGRT
NIELREQFILADGVSQSMAAFTPRRSTPNAAATASSSPHAHNGGSSNLPPYMSGQGPIIK
VRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGS
RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIPQRKPSTGSTASGTTPRPARL
SVTTTTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSSSIPALTGFGFKPIRRNISG
SSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences A1Z9J0
NP_725337.1.81976 FBpp0086744 FBpp0086744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]