SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086866 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086866
Domain Number 1 Region: 246-387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000153
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086866   Gene: FBgn0033827   Transcript: FBtr0087753
Sequence length 392
Comment type=protein; loc=2R:join(9187160..9187418,9187706..9188324,9188605..9188798,9188871..9188977); ID=FBpp0086866; name=CG17047-PA; parent=FBgn0033827,FBtr0087753; dbxref=FlyBase:FBpp0086866,FlyBase_Annotation_IDs:CG17047-PA,GB_protein:AAF58386.1,REFSEQ:NP_610865,GB_protein:AAF58386,FlyMine:FBpp0086866,modMine:FBpp0086866; MD5=7e30f2dd89898d5b88a7a157070a26d3; length=392; release=r5.30; species=Dmel;
Sequence
MIGYTLLFPLGLLAIAQAQTLNDTASGALAVAQEPGMWRQARRRSVLADSCVTNSGTTGT
CLTRFKCMRQSGTVNGYCGTYGVCCETNLQVGSSTRQKRTIIKNPGVLSSDLNTYTIEAF
SSNVQQLRIDFEQFVMQQPTDVDGVLECQDYFEAGGFKLCGVNDGQHLYLPFNAAAGVDQ
VTLTFVVTSRGTAPVWRLIVTQLEGPPANSRRRSSTSTGLGTSTNSLQDLRDIFASHHAD
YELLAPPGCQQYYTDLSGTIRSFNFQTSVTSNYMPDLSYNICIRSATSASMIEYSFSKFS
MSVQSDSGEGYDEFCHATVHTTGRQEDYLMIPQSILAKNMAYQPTYYCGTNDNLLVYASP
PYMMHFSSDDLTLNRDVETGFSMTYRQRNSLL
Download sequence
Identical sequences A1Z9B9
7227.FBpp0086866 FBpp0086866 FBpp0086866 FBpp0086866 NP_001286385.1.81976 NP_610865.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]