The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0086948 |
Domain Number 1 |
Region: 32-61,178-347 |
Classification Level |
Classification |
E-value |
Superfamily |
P-loop containing nucleoside triphosphate hydrolases |
3.73e-59 |
Family |
G proteins |
0.0000000264 |
Further Details: |
|
|
Domain Number 2 |
Region: 61-180 |
Classification Level |
Classification |
E-value |
Superfamily |
Transducin (alpha subunit), insertion domain |
9.42e-42 |
Family |
Transducin (alpha subunit), insertion domain |
0.00000446 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Molecular Function |
IC (bits) |
H-Score |
Biological Process |
IC (bits) |
H-Score |
Cellular Component |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0086948 Gene: FBgn0004435 Transcript: FBtr0087835 |
Sequence length |
353 |
Comment |
type=protein; loc=2R:join(8503802..8503919,8504045..8504229,8504292..8504446,8504577..8504705,8505300..8505429,8505492..8505645,8505948..8506055,8506569..8506651); ID=FBpp0086948; name=Galpha49B-PB; parent=FBgn0004435,FBtr0087835; dbxref=FlyBase:FBpp0086948,FlyBase_Annotation_IDs:CG17759-PB,GB_protein:AAG22276.2,REFSEQ:NP_725192,GB_protein:AAG22276; MD5=edc0446e6046bbe92682285fe42bfb77; length=353; release=r5.30; species=Dmel; |
Sequence |
MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED
PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPT
TGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN
RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAR
EFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYNLV
|
Download sequence |
|
Identical sequences |
A0A0J9RB68 A0A0R1DQG4
FBpp0086943 FBpp0086942 FBpp0086944 FBpp0086946 FBpp0293494 NP_725191.1.81976 NP_725193.1.81976 NP_725194.1.81976 NP_725195.1.81976 NP_725197.2.81976 XP_015052011.1.41174 XP_016027213.1.80810 XP_016027214.1.80810 XP_016027215.1.80810 XP_016027220.1.80810 XP_016027221.1.80810 FBpp0086942 FBpp0086943 FBpp0086944 FBpp0086946 FBpp0086947 FBpp0086948 |