SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086967 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086967
Domain Number 1 Region: 114-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.97e-90
Family Pancreatic carboxypeptidases 0.00019
Further Details:      
 
Domain Number 2 Region: 25-104
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.17e-16
Family Pancreatic carboxypeptidase, activation domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086967   Gene: FBgn0033774   Transcript: FBtr0087854
Sequence length 422
Comment type=protein; loc=2R:join(8649658..8649819,8649891..8650027,8650090..8650565,8650623..8650919,8650979..8651175); ID=FBpp0086967; name=CG12374-PA; parent=FBgn0033774,FBtr0087854; dbxref=FlyBase:FBpp0086967,FlyBase_Annotation_IDs:CG12374-PA,GB_protein:AAF58456.1,REFSEQ:NP_610819,GB_protein:AAF58456,FlyMine:FBpp0086967,modMine:FBpp0086967; MD5=9d14049177644056a8eb5244bd4f6599; length=422; release=r5.30; species=Dmel;
Sequence
MKLPILLITLVAMVAAKSAPGRMAARYDHFRIYQLTIETNLQMEELKKIHEHISVHFLNE
LGAVGNKYNVIVGPLFHRALEKTLKFLEIVYEVIVDDLQKLIDESSVGDDSQMEWETYHT
LDTIYDWIDQECAAHDFLECKVIGQSYEGRDIKSIRLSKRSGNKAIFLEGNIHAMEWISS
ATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNE
SGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRS
YMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVV
SGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQITEVGLEVTAGLKALVNKAAEEGI
FD
Download sequence
Identical sequences Q7JYV3
FBpp0086967 FBpp0086967 NP_610819.1.81976 FBpp0086967 7227.FBpp0086967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]