SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086999 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086999
Domain Number 1 Region: 285-527,625-679
Classification Level Classification E-value
Superfamily Kelch motif 1.12e-34
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 52-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000638
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086999   Gene: FBgn0033757   Transcript: FBtr0087886
Sequence length 853
Comment type=protein; loc=2R:complement(8516533..8516777,8516833..8516962,8517025..8517181,8517234..8517553,8517607..8517825,8517889..8518490,8518547..8518685,8518768..8519110,8519173..8519385,8519468..8519661); ID=FBpp0086999; name=muskelin-PA; parent=FBgn0033757,FBtr0087886; dbxref=FlyBase:FBpp0086999,FlyBase_Annotation_IDs:CG8811-PA,GB_protein:AAF58483.2,REFSEQ:NP_610801,GB_protein:AAF58483,FlyMine:FBpp0086999,modMine:FBpp0086999; MD5=e43a61f2c353299342bee52eea71ecbe; length=853; release=r5.30; species=Dmel;
Sequence
MSSSSTSSPTDNSSHGSVALSSALNPSLNPVSGTNTSSQKPFSLSERLNFEIYRYSSYSP
NYLPENVLVDCPNDQTSRWSAYTNSPPQFLTLKLRRPAIVKKIKFGKFEKSHVCNIKKFR
VYGGLDDEHMVLLLEGGLKNDNVPEVFNLRCLTEDGSENLPILYLKIVPLLSWGPSFNFS
IWYVELHGQDDPMYTSARMKNYNSLREVEIIKLCLKHFRQQGYLSAFGALQEQTNVQLEH
PLISELHKCLVLQGDFEKAERFIVECIDEGLMDEYLHKQDYKHSWHMKHTESDIKPGNRG
GHQLVVDAKRRLIYLYGGWDGYQDLSDLWVFNIEDDQWTLLCERSELSNGPTPRSCHKMV
FDPISENVFMLGRYLDNSIRTSDYIKSDFYLYDTRAGNWMQICDDTSQVGGPQLVYDHQM
CMDTDKRTIYVFGGKILTPRSVNATGAIEPEYSGLFSYHIATNTWAQILVDCHHASASLA
DVMSIKSRITHCMVFHNKHRKLYIYGGQRGKEDLDEFLSYDVDTQAISVLNKEHPHHGTI
AGNEAKFEPSSGYTLRATIDCERDEIYIFSSLSKVKDRRDIQHIDASNSFWVYSLRNHKW
SRIYYCRHSGQDANSINNMNILGASKGDGTLEPCPRYAHQLVYDDVTNTHYLFGGNPGIC
QQQQLRLDDFWLLCLEKPKREEILKHCRFLVRKLRYEEMTRQDPLKAMQYLRHHIADVID
HSDAEQLNNFHKLASLLFKNHDGNLDRECNTPALCADADDLETDSDVSAKIKEELADGPA
TENLSLESNESMISSGISETASSPSSSSCTKRARTDCTPELKNKRAFLFNKLVQLMPPSM
VQPERNLSDFVVM
Download sequence
Identical sequences Q0E9A5
FBpp0086998 FBpp0086999 7227.FBpp0086999 FBpp0086998 FBpp0086998 FBpp0086999 NP_610801.1.81976 NP_725200.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]