SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087015 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0087015
Domain Number - Region: 1596-1887
Classification Level Classification E-value
Superfamily ARM repeat 0.000161
Family Armadillo repeat 0.083
Further Details:      
 
Domain Number - Region: 10-90,416-678,718-860,942-1048
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family HspBP1 domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087015   Gene: FBgn0033718   Transcript: FBtr0087904
Sequence length 1977
Comment type=protein; loc=2R:join(8232591..8236028,8236088..8238583); ID=FBpp0087015; name=ana3-PA; parent=FBgn0033718,FBtr0087904; dbxref=GB_protein:AAF58528.2,FlyBase:FBpp0087015,FlyBase_Annotation_IDs:CG13162-PA,REFSEQ:NP_610765,GB_protein:AAF58528,FlyMine:FBpp0087015,modMine:FBpp0087015; MD5=33efb505f7d2b651b4059a7e58cae292; length=1977; release=r5.30; species=Dmel;
Sequence
MSTKQSPALQLAEGQLTKLTSESEEIRMRALDQIETRFIRCLQLGEPIQFKPVLLLKQLI
RWFGYTPPLVPDRVLAMIMELLRSEYAEAVIRKIPYERFKAELQKVRRVLHKQESKRVSE
LLDDMNLLLLEKYNIDRVTPSVSSLSSNDIPSQATESADSSSNQIYDNLKPEDYEPSWSH
PCLDDVATMKSMIDLPRNSVELQLQLTELIIRMGDYPTEYFLQPPFVFLHLVQLQTMTDG
SLIHVNRALIACLRLLQQRILLRRNTLSYADRFDPPSRPKQVKVVSALVILLENCMKLIR
PLLFSCTNDNWHIMELIVEIVRTHDVLSSKIPLVSITLIADAVKSLLAYCNSVEGSCMTQ
LMDSLRIPRLQSLILNGVLHDMVALNINYDKRMDRRQAKALIQPIVLDSAYLSGMPERMK
SLNTLISSLDSGPSPDEELIKLKRAYSVALNQLHPNTELTGSLLIQKYRQVCLVLVQLGS
ETLVKQLFGAVVKCIPFYAGNLKLRKDADELLYTLVDLPALKLRSLIYRLMIKSTVAHFH
SFMNKTVYMTGCSNVDLIRQHILGVPLTPLLLRRMIIQSSEANTSERMQQWCLDYPIMIM
KLNAILAPQDFSVVFPLLLPVLPLLISRSVTHKILHNVIWNVLEPDSSRLDPQLMLRGYV
YFMFHPDGEVRSEATTTIAYVLQCQEQTNRYLPTASNVPVEHIANDLCIIQPPFCYRSIF
IKCSDERFQGQRSLDALFRLLQAKDIKSNIRKSTMTQLNVLLRNWRACEEFSTKEDGYRL
IMESLHNALKKGNDTDILLPTVSILMKLLFNDDEFRLEVANTFGVYTLLLRALFLFPHLE
QLRQDVSICLFQMLFQNCITSTEDKLVLNANMEPLILPVTYEIEHKVIPTAVTEGLELQQ
NVEATHFGRDRAKAAQHWRLYMAYRVCQVPSSITLESVSALDIRESLKIKMADLALVRSS
DLNEQLSCQFIAAENCSKHEDLQKTVSAIQLFLVVLRNSLSDTVAENLWKLIHKYIRLAP
GNEADDKVYKSMLDLCVTCIRFSQPHAINGLSYALETDHHHSFQLLLHDSQISLDKLFLI
CQCMMQLLSNELSDDSMNWYGKFFMQLSAVAKTHFELRQLQHVRCILCMLRFVSERNLKF
SNAQLMSYSQHFIQLSSNLRTSTQTGSEWQRDCLYIICQLQIHLIYQEPKASSKASIPND
VGASYKVLRYFLTLCGHGDSEVRALSWVSLANWITICGSQVAEILPRLDFLPGGLPACCL
TTLTDAHEMMLIRELAGRVFILLMPLIGAESSLELLRKHDLLKTAYNSLKAIHDTPWMFK
KIVGERHSCEVISCYVAICTKMVAMKPEWCAALCGHSLMSGLSDVMKKLKSQASCSIPLV
ELCASQICELYSMCYTNNFEFLKMTICRDSVFLQNYLTLINDVLSLECPEYMVIPLLKMF
LIFCTDSNSNSFLIEQIKNKPSLFMDFFLFGLHVKLINSPFQRFTLSALSLVFTKAQLAA
YDISMLSELEKFELAFSDPDIAKDGKQEFESKKKQSVSQCIYDESSDNSDDNKQRPNHAI
QATNAAIIIFHRLDQLFDRYYLSKALNFLELPAVGQVQVCEALGELLKASTWAVKAAGES
KLLGKVVHILDDFLNDEKIGNAAVYVKRVGPHKAQSIISNLLVLINMLSQWHSSPNSEII
QTSMAANIAKILIRIWPWLSHSYHLKKVTVQLIMFLTEHSFEMCKQISLLQSGHAQSLLH
LMARVADFETTKKEIPNKEPSLNMVPALRVMVNCCCCTEGRLSLSKMNLLDMFDTILPAN
PCSTHLKVRPPVLIAWLGFWEVFSRYDVGGKACHLQSLINTIRRSPPLSHKRILCLRILR
NMCFFNGNRPRLVELADFINLLRDILEQRVQKAPTSEKNGLNSFEEHRLAVLMLWKLFGF
GAKYKGMLRGTKLFKLLIGLRVEMSVVFSEEENKYAGVPYANDLAKLLEKLMESMRQ
Download sequence
Identical sequences A1Z8X3
FBpp0087015 FBpp0087015 FBpp0087015 7227.FBpp0087015 NP_610765.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]