SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087147 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087147
Domain Number 1 Region: 110-179
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000111
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087147   Gene: FBgn0026573   Transcript: FBtr0088041
Sequence length 1125
Comment type=protein; loc=2R:join(7858487..7858580,7858643..7859111,7859230..7860545,7861063..7862013,7862096..7862643); ID=FBpp0087147; name=CG8290-PB; parent=FBgn0026573,FBtr0088041; dbxref=FlyBase:FBpp0087147,FlyBase_Annotation_IDs:CG8290-PB,GB_protein:AAM68703.1,REFSEQ:NP_610716,GB_protein:AAM68703,FlyMine:FBpp0087147,modMine:FBpp0087147; MD5=1b875dc1673ffa9239a1824c5fdb795c; length=1125; release=r5.30; species=Dmel;
Sequence
MSNSAPGSESGLAKVATPSPSPLAKLDADFTSSKFEMHPSLSDEERRFYLKMYPNVDLVN
QRKVHCTVCKLHLGTAPAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWC
GQGGEVYCCSTCPYVFCKSCIVKNLSKGVIVDIEQNENWNCFSCTSKILWPLRAQHWALV
NYLQTQKRALQTLQLPEVEARRQMLKDNSNCCRLAKSKTSSLSDSMESLESNVSKRSQGS
SAGSSKRGSMPKTIPPGPPSKRAKASNNEVVCTPDLLSMLEPDCQLSVTPKPTGRQTVTA
ANITTPRIVTVQQNYQPGQSSSNSGSNGSVSGSSSVPPTRSSLPPPLVLSGSGIRYRQNA
PGGVSGVVRRTVVPNSVKTTGPVFHTINGFKVDLNSAAQQDSYRLPNGRLIQVKRQVPQT
IQPASTVPTPPTPPALVVPQVGPGVVIRPRAPITTNRPSLHISTYGSNMGIYNPQTNQQQ
RAPQVRVGNANPAPPPLQGLPPNANGGQTLMITPAPQPAPKVPTLVRLTFPNTPMGQARA
QLQEQIFSAMDICTHLTGKVVSLTHSNAYNQVRSYLELKELYIHMSYLMTYAIGRFKNLQ
EKCLVDMREKGFKNDANSLENGQLAAAVDYVCYGQLDDVDLFNTGCNSFHNQVYEYRKSL
HANLKDGEDCEPLPPLMPLGVRAEGDPIDEPEEPETVPEPQQDDTEKDHEDAAEFDYDEP
EDLDDDLDDDDLDNEECGELGTEESMNRNEQAHAYDRKLTRLLREYPSLWCTRHPDYGKK
EVTNKQWRVIASHFPRGDDIKLRWKNVRKRYVRIERRLKQGKRFKGYFDKATNYLENRDR
PRSEWLAVDCGEDDGDGFERKHLDVIENKMEQKAHKQPAVKINLKGGSRIPTRPLEVRPI
DQRIITFAKSHPVLWRKSADPEFNSIDEQTRKSLWQNFWKSAPNYACEYLVERWQQMYEM
YKSFRLKSIKDKGIFANLELKYSKYLASLYFLYKIDEQDLRDEFEPLQDCVPSGTDSAGN
LKDMPDDKQFCQQLVLAMRAYPTLWNPRHVDYSDVGARERLWPEVARRLPRFKRDAQACK
LRWQMAKFAYECYLREMERHPRVNERKLQKLRSNFPLEEMRFLNI
Download sequence
Identical sequences Q961B8
FBpp0087147 FBpp0087147 NP_610716.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]