SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087438 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087438
Domain Number 1 Region: 324-542
Classification Level Classification E-value
Superfamily GFP-like 4.71e-58
Family Domain G2 of nidogen-1 0.00037
Further Details:      
 
Domain Number 2 Region: 1046-1285
Classification Level Classification E-value
Superfamily YWTD domain 1.11e-36
Family YWTD domain 0.00000419
Further Details:      
 
Domain Number 3 Region: 940-1037,1297-1338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000675
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 588-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0087438
Domain Number - Region: 549-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000136
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 759-879
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 285-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-like domain of nidogen-1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087438   Gene: FBgn0026403   Transcript: FBtr0088349
Sequence length 1350
Comment type=protein; loc=2R:join(6201779..6202009,6203906..6204385,6204481..6205242,6205349..6205972,6206233..6206503,6206567..6206712,6206773..6207182,6207376..6207533,6208078..6208332,6208389..6208563,6208626..6208910,6208974..6209229); ID=FBpp0087438; name=Ndg-PA; parent=FBgn0026403,FBtr0088349; dbxref=FlyBase:FBpp0087438,FlyBase_Annotation_IDs:CG12908-PA,GB_protein:AAF58809.3,REFSEQ:NP_610575,GB_protein:AAF58809,FlyMine:FBpp0087438,modMine:FBpp0087438; MD5=d120ce1693a0618b464991ddae3512f2; length=1350; release=r5.30; species=Dmel;
Sequence
MPTFGSKLLACLLLSSVILVSGQFEHYLDSLRASELYEFEDGSLGSIHLLPKGDSETIVL
QLEQPIHFYGEQYEQLYINTNGILTFNSEFPEYLNQPFPLEYASIAAFYSNVDTSFSDEG
TSISLFESKEQSILDRASSLVRYAFSSQSEFEARQVIVATWRNVGYFDSKTDRLNTFQVA
LIANEQSTFVQFIYPDGGLNWLQGETAGLGLPDIRAQAGFVAEDGRFYTLNGSGSENARF
LSESTNLGVPGVWLFEVAPIENEQNVRSPDNAESLTESPALALSCQAHAHQCHEKAECHD
KAEGYCCVCGSGFYGNGKSCLANDQPIRVTGTLTGELNKQPVSEEAKLQSYVVTSEGRTY
TTINPLTPELGAQLRLVLPLLTTVPWLFAKSVGGVANGYQLTGGVYTHVSRLQFDSGENL
HVNQTFEGLNYWDQLSVKIEIYGEVPAVAADAVLILPDYVEEYTFERPGELKSVQVLNIN
ITEEQRVLGLQVEQRILYRSCLRDDEADPSATKVLQKISKVALDYVERDQALRIGAMSKV
GVTPESNACNDGTADCVENSVCVPYEDTYRCDCYHGFAAQLDERGVEVCLDIDECATGSH
VCDENAVCDNTEGGFNCYCTEGFEGNGYRCLSNSTADNIEYPPAVEGQAEPTSEPSPNPS
PYPDQGQDQEREREDDQYPQPNPYPYPEEQIPQHPDECYRCSKDADCYQGRCTCHEGFDG
DGYTCTNICGHGEVWENGRCEPLLLERHDVDPLCDALGECRCPYGYELSEDSQRCTYVQE
FDGERNADLIPCDVDENCHINATCNWYGQELRHICTCQPGFRGDGYNCDPISDDSCAIRP
DICDVHADCVYEEHLGKSECQCQAGYTGNGFNCQLAAECQSAEHCGENAFCDDGVCRCQA
DFERDVSDRCVPAGRCGSVFCGSNAICKWDSAEGVQYCDCLDGYQGDALTGCTSKPLSCH
VLNNCGIHATCEPTEDPANYECQCIAGFKGDGYVCIEEQNCLNNPTLCDMNAQCRSTNSG
LVCVCNQGFFGNGSLCQERQHQDSDFLIVSQGVMIARVPLNGRNVRPISVAQMAIGLDKD
CVEGRVYWGDISTKKIVSTKYDGTDLRPFITTDIESPEGIAIDVISRRLYWADSAKDTIE
VASLDDPSLRAVIINKQLVNPRGIAVDPYREKLFWSDWDRESPKIEMSNLDGTGRELLLG
KDDVTLPNSLVVLENSGEVCYADAGTKKVECIEPQNRQIRTISNELSYPFGITFTHDQFY
WTDWTTKKVEIVDSLGARQTPIQPPFFGSHKMYGMTVVEQHCPQYQSPCQISNGGCTDSR
LCLVNRQAPSGKSCKCTSASTGCTVLAPGY
Download sequence
Identical sequences A1Z877
FBpp0087438 FBpp0087438 NP_610575.1.81976 NP_995796.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]