SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087439 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087439
Domain Number 1 Region: 324-542
Classification Level Classification E-value
Superfamily GFP-like 4.81e-58
Family Domain G2 of nidogen-1 0.00037
Further Details:      
 
Domain Number 2 Region: 1066-1305
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-36
Family YWTD domain 0.00000419
Further Details:      
 
Domain Number 3 Region: 960-1057,1317-1358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 588-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000349
Family EGF-type module 0.028
Further Details:      
 
Domain Number 5 Region: 549-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000454
Family EGF-type module 0.038
Further Details:      
 
Weak hits

Sequence:  FBpp0087439
Domain Number - Region: 284-321,594-632,679-777
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 759-895
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087439   Gene: FBgn0026403   Transcript: FBtr0088350
Sequence length 1370
Comment type=protein; loc=2R:join(6201779..6202009,6203906..6204385,6204481..6205242,6205349..6205972,6206233..6206503,6206567..6207182,6207376..6207533,6208078..6208332,6208389..6208563,6208626..6208910,6208974..6209229); ID=FBpp0087439; name=Ndg-PB; parent=FBgn0026403,FBtr0088350; dbxref=FlyBase:FBpp0087439,FlyBase_Annotation_IDs:CG12908-PB,GB_protein:AAS64880.1,REFSEQ:NP_995796,GB_protein:AAS64880,FlyMine:FBpp0087439,modMine:FBpp0087439; MD5=eb5ba7f01d1f9f469a47ef6be4e0f1aa; length=1370; release=r5.30; species=Dmel;
Sequence
MPTFGSKLLACLLLSSVILVSGQFEHYLDSLRASELYEFEDGSLGSIHLLPKGDSETIVL
QLEQPIHFYGEQYEQLYINTNGILTFNSEFPEYLNQPFPLEYASIAAFYSNVDTSFSDEG
TSISLFESKEQSILDRASSLVRYAFSSQSEFEARQVIVATWRNVGYFDSKTDRLNTFQVA
LIANEQSTFVQFIYPDGGLNWLQGETAGLGLPDIRAQAGFVAEDGRFYTLNGSGSENARF
LSESTNLGVPGVWLFEVAPIENEQNVRSPDNAESLTESPALALSCQAHAHQCHEKAECHD
KAEGYCCVCGSGFYGNGKSCLANDQPIRVTGTLTGELNKQPVSEEAKLQSYVVTSEGRTY
TTINPLTPELGAQLRLVLPLLTTVPWLFAKSVGGVANGYQLTGGVYTHVSRLQFDSGENL
HVNQTFEGLNYWDQLSVKIEIYGEVPAVAADAVLILPDYVEEYTFERPGELKSVQVLNIN
ITEEQRVLGLQVEQRILYRSCLRDDEADPSATKVLQKISKVALDYVERDQALRIGAMSKV
GVTPESNACNDGTADCVENSVCVPYEDTYRCDCYHGFAAQLDERGVEVCLDIDECATGSH
VCDENAVCDNTEGGFNCYCTEGFEGNGYRCLSNSTADNIEYPPAVEGQAEPTSEPSPNPS
PYPDQGQDQEREREDDQYPQPNPYPYPEEQIPQHPDECYRCSKDADCYQGRCTCHEGFDG
DGYTCTNICGHGEVWENGRCEPLLLERHDVDPLCDALGECRCPYGYELSEDSQRCTYVQE
FDGERNADLIPCDVDENCHINATCNWYGQELRHICTCQPGFRGDGYNCDPISDDSCAIVS
DYSPIYDIPMTASLKPLQRPDICDVHADCVYEEHLGKSECQCQAGYTGNGFNCQLAAECQ
SAEHCGENAFCDDGVCRCQADFERDVSDRCVPAGRCGSVFCGSNAICKWDSAEGVQYCDC
LDGYQGDALTGCTSKPLSCHVLNNCGIHATCEPTEDPANYECQCIAGFKGDGYVCIEEQN
CLNNPTLCDMNAQCRSTNSGLVCVCNQGFFGNGSLCQERQHQDSDFLIVSQGVMIARVPL
NGRNVRPISVAQMAIGLDKDCVEGRVYWGDISTKKIVSTKYDGTDLRPFITTDIESPEGI
AIDVISRRLYWADSAKDTIEVASLDDPSLRAVIINKQLVNPRGIAVDPYREKLFWSDWDR
ESPKIEMSNLDGTGRELLLGKDDVTLPNSLVVLENSGEVCYADAGTKKVECIEPQNRQIR
TISNELSYPFGITFTHDQFYWTDWTTKKVEIVDSLGARQTPIQPPFFGSHKMYGMTVVEQ
HCPQYQSPCQISNGGCTDSRLCLVNRQAPSGKSCKCTSASTGCTVLAPGY
Download sequence
Identical sequences FBpp0087439 FBpp0087439 FBpp0087438 7227.FBpp0087439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]