SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087482 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087482
Domain Number 1 Region: 40-137
Classification Level Classification E-value
Superfamily alpha/beta knot 2.25e-18
Family Hypothetical protein MTH1 (MT0001), dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087482   Gene: FBgn0033473   Transcript: FBtr0088394
Sequence length 250
Comment type=protein; loc=2R:join(5915133..5915148,5915213..5915949); ID=FBpp0087482; name=CG12128-PB; parent=FBgn0033473,FBtr0088394; dbxref=FlyBase:FBpp0087482,FlyBase_Annotation_IDs:CG12128-PB,GB_protein:AAS64882.1,REFSEQ:NP_995790,GB_protein:AAS64882,FlyMine:FBpp0087482,modMine:FBpp0087482; MD5=c839acdfa5ee47a2549eb29a5a6dc4e4; length=250; release=r5.30; species=Dmel;
Sequence
MEPQSESCRKQRGTLVSPDEPRRETGVYWGYQVRIAHSMSEIFTKSPYATGYDVTVGTSD
RGTNVHEVPNRSYNFNHMLIVFGGLQGLESALANDEKLTVDDPELLFDHYVNVLPRQGSR
TIRTEEALLIALAALQEKLQPQVADVEIDLTDLLPKSEDSGIAVRRDVLVSKKQKKRKQV
EDTPDETVVDEPSFSKPLPKVARLTANPFADSSEELAKNTPAQDDFEVVSSTTVSGTSHS
CADDDLSRFD
Download sequence
Identical sequences A1Z831
NP_995790.1.81976 FBpp0087482 FBpp0087482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]