SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087626 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087626
Domain Number 1 Region: 191-228,435-513
Classification Level Classification E-value
Superfamily SET domain 8.9e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.057
Further Details:      
 
Domain Number 2 Region: 223-270
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000192
Family MYND zinc finger 0.09
Further Details:      
 
Domain Number 3 Region: 33-132
Classification Level Classification E-value
Superfamily TPR-like 0.000035
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087626   Gene: FBgn0033427   Transcript: FBtr0088543
Sequence length 718
Comment type=protein; loc=2R:complement(5469319..5469578,5469634..5469955,5470010..5471030,5471086..5471639); ID=FBpp0087626; name=CG1868-PA; parent=FBgn0033427,FBtr0088543; dbxref=GB_protein:AAF58923.1,FlyBase:FBpp0087626,FlyBase_Annotation_IDs:CG1868-PA,REFSEQ:NP_610500,GB_protein:AAF58923,FlyMine:FBpp0087626,modMine:FBpp0087626; MD5=32b4de050f0495fde17de995d91e61be; length=718; release=r5.30; species=Dmel;
Sequence
MPADILQIFQKLALDLLQDLEQPVDRKGCAERSKNLREEGNLMFKESASGSSKDSVLKAC
RLYSEAVFEAENAVEELSLAFANRGIALQEYGYYREAYDDCSNALECGYPERLRHKVIMR
QAFCAWKLKKIASLEEHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDK
SLGEILTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCP
NCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEM
TSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKE
HTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPEL
WQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEG
EEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQ
EFLPDAKVQQNNLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFK
AFDDLDKWLVDHHSLKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQC
GDNSTEYIARMTYLWDIIAQKKCRTDRKELLEMKGKVDYLASEHREVFLNYYNDFIEQ
Download sequence
Identical sequences Q7K4R6
FBpp0087626 FBpp0087626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]