SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087660 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087660
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.51e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00077
Further Details:      
 
Domain Number 2 Region: 83-193
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087660   Gene: FBgn0033381   Transcript: FBtr0088579
Sequence length 226
Comment type=protein; loc=2R:join(5009859..5009953,5010024..5010072,5010127..5010663); ID=FBpp0087660; name=CG11784-PA; parent=FBgn0033381,FBtr0088579; dbxref=FlyBase:FBpp0087660,FlyBase_Annotation_IDs:CG11784-PA,GB_protein:AAF58982.1,REFSEQ:NP_610457,GB_protein:AAF58982,FlyMine:FBpp0087660,modMine:FBpp0087660; MD5=0fca5ef0b7be9ec37d3a532f09e291a6; length=226; release=r5.30; species=Dmel;
Sequence
MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVD
SDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNI
YGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVERE
KYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSCMAENKAKSQ
Download sequence
Identical sequences Q7JVI6
7227.FBpp0087660 FBpp0087660 FBpp0291657 NP_001188889.1.81976 NP_610457.1.81976 FBpp0087660 FBpp0291657 FBpp0087660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]