SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087868 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087868
Domain Number 1 Region: 3097-3357
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00001
Further Details:      
 
Domain Number 2 Region: 1317-1585
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-46
Family YWTD domain 0.00000276
Further Details:      
 
Domain Number 3 Region: 2256-2524
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-35
Family YWTD domain 0.0000333
Further Details:      
 
Domain Number 4 Region: 1952-2210
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-30
Family YWTD domain 0.00021
Further Details:      
 
Domain Number 5 Region: 3923-4156
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-29
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 6 Region: 1637-1884
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-28
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 7 Region: 595-842
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-27
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 8 Region: 346-532
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-21
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 9 Region: 3012-3087,3351-3412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-18
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 1232-1325,1578-1630
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000282
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 11 Region: 153-237,538-582
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000133
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 12 Region: 2753-2791
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000122
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 13 Region: 3523-3563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 3607-3645
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 15 Region: 2612-2654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 3440-3480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 17 Region: 34-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 3805-3843
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 3643-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 539-577,866-916
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000298
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 21 Region: 3562-3600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 22 Region: 2575-2614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 2673-2706
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 3723-3756
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 25 Region: 3759-3801
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 26 Region: 3685-3724
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 2832-2864
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 2934-2967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000903
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 3404-3440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 77-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 2883-2918
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 32 Region: 2973-3009
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 33 Region: 2716-2751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 34 Region: 2794-2825
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 1142-1179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 36 Region: 1009-1044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 37 Region: 4400-4442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number 38 Region: 1089-1126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 4365-4398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000256
Family EGF-type module 0.023
Further Details:      
 
Domain Number 40 Region: 1048-1086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000275
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 41 Region: 4327-4363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000039
Family EGF-type module 0.012
Further Details:      
 
Domain Number 42 Region: 3484-3526
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000903
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  FBpp0087868
Domain Number - Region: 4453-4491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000264
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 1192-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000275
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 2212-2260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 4249-4295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000493
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4293-4329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 927-960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00102
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 4496-4530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00197
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 121-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00262
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number - Region: 3845-3881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00524
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2529-2577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00931
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1893-1945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0141
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 970-1006
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0445
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 4213-4247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0898
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087868   Gene: FBgn0053087   Transcript: FBtr0088791
Sequence length 4699
Comment type=protein; loc=2R:join(4094023..4094245,4097011..4097130,4097219..4097341,4097590..4097841,4097906..4098229,4098480..4098856,4099032..4099777,4099836..4100903,4100971..4102729,4102805..4103085,4103151..4103506,4103565..4103833,4103889..4106003,4106283..4106952,4107024..4109061,4109151..4109537,4109599..4110412,4110484..4111048,4111116..4112448,4112506..4112632,4112768..4112920); ID=FBpp0087868; name=LRP1-PC; parent=FBgn0053087,FBtr0088791; dbxref=FlyBase:FBpp0087868,FlyBase_Annotation_IDs:CG33087-PC,GB_protein:AAF59114.3,REFSEQ:NP_788284,GB_protein:AAF59114,FlyMine:FBpp0087868,modMine:FBpp0087868; MD5=fb915a579d887c585151f2adca76dc60; length=4699; release=r5.30; species=Dmel;
Sequence
MQTVAETQMIEWLAACTSSFFLCILSDHYSVIYPIAGPCPASYFTCNDGFCIPMRWKCDS
KADCPDMSDEGSECAPKCNEGQFRCGVSRHCIPNNWLCDGEFDCGKGDISDELNCPNGDT
PKCRAFEGQCRNGDCLELSRFCDGRWDCDNDELQCDKQNAACAALNCSFNCKLTPQGARC
YCPKDQVPESSNSTRCVDYDECSEPGTCDQVCRNTPGSYECSCVSGYAKTKGNRCRAINV
PPTEPTTLIFLSRDGVQSVGTNGTEVIGPPGAKDNDKVTDKDGVGSEEELLLSQPLRFVH
AFEVWHRNRTLCSLLFSWPELQMRCQRVDDARVNWTLPFSSFVSPQQFFTELRLDWLSGN
WYLVSEDDGLVYLCTNAMTYCRVILQQVDPLSSLDLDPTKGFMFYTDWTPSLSRSLLDGS
NRTVLVTDQVYHPSSVTLDLANELVYWIDIYKDEVNRVDYEGRNRWTLKRPLDSPVPLKT
IHAVEVFENSIYLAAWMDTAIVALDKFSLKTHILQSNVSRGANLRIFHRQKQPEVAHPCR
DNNAGCNQICVPQWTKGFASAKCMCTAGYKLHNQTTCLLSALDKFLVYSDKHLARISGIP
LDTEQVQQLEQIGEQPDVMVPVYNVSKTLAIDVNVRGKAVFYVVADSGASPFGNGEPSCS
IRSQSLNGSVSRLLAQGLKRVHAVAFDWINDHLYWTSHKKMQVAPLRNLSKVLTFNTDCD
AMSLELDPTTGLLYWSQWESQSCEAGIYSSWMDGTHKELLAKGTSSMPMQWPRSLDVDRR
TKELYWCDIRLSTIELMRLDGTGREVLFKSDQFHPYSIVQNNGLIYWADNKNSTILRFHA
HQANLSSTFSSTVHLQRTGRAADLRIFDIASQPLPQTPSACAQSKCPGMCLNTPKGAICR
CPDGFTLNGTGSHCIPQLAPSPIRPNCTSGYMCRSTRQCLDTKDMCDGFEDCEDGIDESS
DPKGPCNVNTCDKTHNFVCNGRCYQRSLLCSTIPYCSDGTDQANCHQNTCNSNEFTCHKS
GRCIQLTWVNDGVVDCGPDDDSDETSETIFASKCPEFDCNNGRCRQFADVCDGIDNCGNN
ADEMECEQECEHGEKYCRPIGCYGEMHMCDGIHDCLDFSDEANCNQTKSDNHPVTEWKEL
GECAPLEFACMFPFECIPDFLRCDGISHCFDKTDEFNCTHINTTRFDMNETVICEHPDRL
CGFSKQCVTVDQLCDGKNDCEDTTDEGFLCADKLCDRGHECSHRCHNTPEGYICSCPDHL
YLQPNGKRCSMQHACDHWDTCSQVCESSGKGYDCRCLDGFDLGFDRFTCKSTAPDEPYVI
FTNRQDIKGINLKTLNVGNFYSSLRNIIALDFLYNNESNVEIYWTDVIDDKIYRGHLVGE
SLRNVEAVIHSGLSTTEGLAVDWVGKNLYWIDSNLDQIEVAKLNGSFRRTLIAGNMESPR
AIALDPREGLLFWTDWDDNSPRIERASMSGDGRRMISTSWQLSAGWPNGLTLDYTQKRVY
WVDAKSDSISSTMYDGSEHHVVLRNKEILSHPFAISVFENYVYWTDWRTTSVIRANKWNG
SDVQVLQRTQSQPFGIQVLHSSRQPWDRNPCGENNGGCSHLCLLSGRGTFKCECPHVMRL
DPANERNCVPNEQVLLFVMVDEIRGIDLHQPNHHTIPTIRQSPRRIDFLVDESRIFWSDI
QQNEISSAGISNGLIEPIINTNIEKPYGFAVDWIARNMYFSSGQIKCNILASNLKGEFAS
IIHEDLNMVDSIVLDPANGKMYWIHSASDGSMSQLEQSNLDGSSRSLIYQHENNLQSLTM
DFDSQRLYYAYDNSGIAYYDIPRNETRKVLVASPITSISSLTVYNGTLYFPENIQSVIMQ
CEKEACSNMSYLRVNTKSIQSMKMFYADAQTGSNTCAEWAYRGGCQQLCLATSSIDHVCR
CALGYDVEPNNPTGCVPRAEFIFYSIDVLQGVEMIDPSEQFDTPSPALVPISRVSSASFI
DYLANTDTLYWGDNELGSISRVKRDGTQRETILEALNLVGYKQQDWLGGIAIDWVAGNIY
WSDTKRNIIEVARLDGSHRYVVVSNLEKPTALAVDPLQGLLFYVTQQHIGRVGLDGSQPF
VLVNQTRANWAVGSLVLDIEATKVYWCERYPDALMKVDYDGNLREQLLNESLNNPVALAK
MGDYLYWAENKYNEGIIRVAPLANLSQSKVVLQTEQDAIRDLKIYSKHLQRGSNPCAHSN
GACEQLCLFNGTSAVCACAHSRLASDGYSCEPYENFLLFSYRSNIESIHMTDHADKNWPV
QMISNTSLMRNVIAITYNYEEQLVYYSDVQLSTINQVHFNGTGHRVLLEQQQRVEGLAYD
IVNEQLFWTSNNNATIRSVELRHLSEHADQNQVHVKKVLSLREDDKPRGIAVEPCLGMIY
WTNWNEGSPCIQRSYLTGYGTEVIIKTDIKMPNALTLDLEQQKLYWADARLDKIERTNYD
GSNRVVLAHSTPKHAFAMAVYGDLLFWTDWVLHAVVRANKYTGTDVLFLREHVTRPMGIV
AVQNTSINCDANQCKILNGQCEDVCILNKSGQATCHCTQGVLAPDGRRCIAPVNTSCGLS
QYNCHSGECIPLELTCDNVTHCADGSDEFRSYCIFRQCPETHFMCQNHRCIPKEHKCDGE
QQCGDGSDETPLLCKCQSEDIDMHPSNNNTKEMPDMFRCGSGECIPRKFLCDSLKDCRDF
SDEKMCAPIPCEKNDMTFVHCGNSTICIMPRWRCDGDPDCPDGTDELDCANHTSLSCDPG
QFRCASGNCIAGSWHCDGEKDCPDGSDEINCRTECRHNQFACDKTCIPASWQCDGKSDCE
DGSDEGPQCPNRPCRPHLFQCKSSGRCIPQKWVCDGEKDCPSGLGDEGSEDEGPQCGGVA
HIPDCPPPAHLCTSGLCIDSHYVCDGDEDCPGGDDEYEGCVPAFQPHSCPGGSLMHQCQD
GLCIFKNQTCDGKPDCGDGSDETSSLCAHTRGCNGTDDFRCKNGACIHADLLCDRRNDCA
DFSDEELCNVNECLIPDICEHECEDKVVGYQCHCRPGYKVLPKSPHLCTDIDECDEQQPC
SQTCINTYGSYKCLCAKGYALVDHHTCKATSNVSMELIFSNRYYIRQVDMTGNGSILINE
LSNAVALDYDWDSQCLYWSDVTSTVGTIKRYCPKENKTQTLHQAMLKNPDGLAVDWVAKN
LYWCDKGLDTIEVSQLDGKYRKVLINEYLREPRGIALHPYQQHIFWSDWGDSPHIGKAGM
DGSNPKMIIRDGLGWPNALTISFETQQLFWGDAREDTISVSDLDGNHTRLLLARSINPLL
NLHHIFAIAVWEGHIYWSDWETKSIEYCSIFNGQNCTTLITTIHRPMDLRVFHPYRQQQP
MSGNPCLAANCSTLCVLSPEEPYYKCMCPTNFILADDGRTCRANCTAAHFECVNTYKCIP
FYWRCDTQDDCGDGSDEPETCPPFHCEPGQYQCANKKCTHPSNLCDGINQCGDGSDELNC
DKFTCFDNHMKCGATANSSAFCVDNVKRCDGVKDCPGGEDESACTPLVCKKDQFQCGNNR
CMPFVWVCDGDIDCPDKSDEANCDNVSCGPNDFQCDSGRCIPLAWRCDDDHDCPNGEDEP
ASCFSSKATCDPTYFKCNNSKCIPGRWRCDYENDCGDGSDELNCQMRNCSESEFRCGTGK
CIKHNYRCDGEIHCDDNSDEINCNITCKENQFKCAAFNTCINKQYKCDGDDDCPDGSDEV
NCTCHSDHFSCGNGKCIMSRWKCDGWDDCLDGSDESLETCAKTHCHANAFKCRNQLCVRN
SALCDGINDCGENEDESDAVCAALPKCRHDQFQCENDDCISKAFRCDGQYNCVDGSDEMN
CQPPVCGFGSCSQICIEKKAGHYNCKCADGYHKGPEKNATCLASGPDQILLLASEQEFRF
ILPAKQEGTTVVGFFQTDSLKIDVFDILIRPKDTLLFWIDSHHGKVHTMKIATPHVEGTG
VRVRRDLKELTAFNIPELDDPKSLAVDWISQRVYIIDSRHNQILATDIEGKKYISLVSTG
MNPTDIVLEPESRIMIWSTLENGILVASLDGSNKKSLVERDVGWPISLSMDYPTGRLYWA
DYRKGTIETCRLNGKDRNVVRRFGNREKPQKIDVFEDYLYIKLYDQSIIKMNKFGNDNGT
YLLKGYRSSDIGILHPMKQNRNISNPCAKDPCKSSRALCILSSESSVGYSCKCAEGYVMT
DDGVCKAHADIPDYCPLQCNLGTCKIVDHVPKCICQPQFEGELCEHYRCSGYCQNYGVCS
VAPALPGSQEPPPLKCTCTAGWSGARCETSMPACQSRCHNGGSCLISETEGMKCSCPKMF
TGEQCEHCRNLTCENGGICRETLTGTPQCECPDGFTGKRCEIDECADFCKNGGSCVISTK
GQRQCKCPSGYFGEHCESNSCRDFCRNGGTCSERGGRLSCTCPPRYIGESCESDLCKTSS
PPHFCDNTKVPTRDPCTLMICQNAGTCHIIKGVALCNCTDQWNGDLCTLPVTDDNPCARY
CANGGVCHLDEYRLPHCSCIGEWQGNACEMPPHCVGGECNVCRPGSSINECLCENNRVVP
CLSDSADALKEEQEPTESGGVFSVVVLVLAVILLVFALFAGAVYFLKKHRIAQPFSHARL
TDNVEIMLTNAMYRGDADEAPTFASEDDKGNFANPVYESMYADAIPEPVSTEITHSTAPD
ERKGLLQHTHDENHTPDIL
Download sequence
Identical sequences 7227.FBpp0087868 FBpp0087868 FBpp0087868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]