SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087988 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087988
Domain Number 1 Region: 34-130
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000109
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087988   Gene: FBgn0050492   Transcript: FBtr0088914
Sequence length 983
Comment type=protein; loc=2R:join(3517697..3517833,3521721..3521819,3522264..3522505,3522559..3522705,3526103..3526410,3527209..3527376,3527436..3527556,3527622..3528122,3535802..3536015,3536088..3536202,3537816..3538313,3538367..3538507,3538574..3538713,3538774..3538894); ID=FBpp0087988; name=CG30492-PA; parent=FBgn0050492,FBtr0088914; dbxref=FlyBase:FBpp0087988,FlyBase_Annotation_IDs:CG30492-PA,GB_protein:AAF59220.5,REFSEQ:NP_724586,GB_protein:AAF59220,FlyMine:FBpp0087988,modMine:FBpp0087988; MD5=7db6454a0498d2cb5c3411d03a89cbf3; length=983; release=r5.30; species=Dmel;
Sequence
MRPYICLMELPINRPGSGNLLLGLTSVVGLIGGAYLLQCGAQQLLGKLANKKWRKEESSS
EDHACNVCCADLDLSSAKNYVTCCTCEKSVCRGPKCADWRPKDAKWECQLCQSSKESLAH
TSSWVAEQMSFNQHKFVYPMRARSEVYIPIVGDGNDSSMQFESVSQIGQNAHMDERAKIR
EYVEEIVAEMLGGNLDHVKVGQLSKSENYLPAIVNGHTNNSNNNNNNNHADSELADLSQT
RLRSLIETIIAETLRSSTLSASGAVSEISLDTRSHVSDLANGNGLKRRHRTEHYFEPKIY
QDLLATAVLNKIVDKEGNTRLAAESTPDLSGRHIDENFNAEALSTTSGSSIEPRSDCSLT
DHEIGLDNGKSQSLQTDLERESVLSDYIAAHMVPLPDFSASVTESEDDIGSISSGMIGDG
NWEDNWLFKKKRSSATPSSIGMLVPAPRENVRAQIGDKTTDEVSDLSEIGSDIEESSLDL
LRCNDLNDRLLSKHLIGGQNTKMVLDELVDRTSLTSHTLPEENEPAFTETTNEFVVSPMA
MPSDIKAPSPTPPPPPMIFQDDLLNEEPDHTPIAGSIAEREVKKWYNAVEMPNNPYSPEA
LKQRISGTQERYMDVPNISPSAEQKALASALTENPDPPAPKADYKRYSRDYYINNAPTST
DSTGGGKAATTSAGEDVEDIVINEARKASQTATEQNPPQESISVYKATPVQVLDESLDSQ
SNPSLYSLQTTTTNTSDESDTVRIYDFNKQETTVIRAAPAEQQPSESTTSSMESAQGAPP
SVSSSIDSSVSQKRERPVVLQFGPGDSVPTIGSPASTPTRGSTPPAFRFLQPKRRLIDPS
QVLSVDEDDVPEPTTPAAEKPVIEDEVAHSMPSVKALAQAFLLTSKHTQPQRRWRAKVRI
AAPPDTPDKPNTSLAKRHKLEHAVSMAEVADESTIASDLSSLETDPSIHSEATPPIASPA
SPVPVRHGFLRSNIAFFENLKFK
Download sequence
Identical sequences A1Z720
FBpp0087987 FBpp0087988 NP_724586.2.81976 NP_724587.2.81976 FBpp0297784 FBpp0297788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]