SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087989 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087989
Domain Number 1 Region: 60-167
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000374
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087989   Gene: FBgn0050492   Transcript: FBtr0088915
Sequence length 1020
Comment type=protein; loc=2R:join(3514430..3514677,3521721..3521819,3522264..3522505,3522559..3522705,3526103..3526410,3527209..3527376,3527436..3527556,3527622..3528122,3535802..3536015,3536088..3536202,3537816..3538313,3538367..3538507,3538574..3538713,3538774..3538894); ID=FBpp0087989; name=CG30492-PC; parent=FBgn0050492,FBtr0088915; dbxref=FlyBase:FBpp0087989,FlyBase_Annotation_IDs:CG30492-PC,GB_protein:AAO41495.1,REFSEQ:NP_788280,GB_protein:AAO41495,FlyMine:FBpp0087989,modMine:FBpp0087989; MD5=628167f82bc9c209c7e5dadc87be5139; length=1020; release=r5.30; species=Dmel;
Sequence
MAGEVPAETSPVGCNTSNSQGSSPHPDPIQQQQLNSSVDSGIAVLEAESPTLRRRQRLHQ
CQRILQVLQRDQLTHQQLRDRLSKLANKKWRKEESSSEDHACNVCCADLDLSSAKNYVTC
CTCEKSVCRGPKCADWRPKDAKWECQLCQSSKESLAHTSSWVAEQMSFNQHKFVYPMRAR
SEVYIPIVGDGNDSSMQFESVSQIGQNAHMDERAKIREYVEEIVAEMLGGNLDHVKVGQL
SKSENYLPAIVNGHTNNSNNNNNNNHADSELADLSQTRLRSLIETIIAETLRSSTLSASG
AVSEISLDTRSHVSDLANGNGLKRRHRTEHYFEPKIYQDLLATAVLNKIVDKEGNTRLAA
ESTPDLSGRHIDENFNAEALSTTSGSSIEPRSDCSLTDHEIGLDNGKSQSLQTDLERESV
LSDYIAAHMVPLPDFSASVTESEDDIGSISSGMIGDGNWEDNWLFKKKRSSATPSSIGML
VPAPRENVRAQIGDKTTDEVSDLSEIGSDIEESSLDLLRCNDLNDRLLSKHLIGGQNTKM
VLDELVDRTSLTSHTLPEENEPAFTETTNEFVVSPMAMPSDIKAPSPTPPPPPMIFQDDL
LNEEPDHTPIAGSIAEREVKKWYNAVEMPNNPYSPEALKQRISGTQERYMDVPNISPSAE
QKALASALTENPDPPAPKADYKRYSRDYYINNAPTSTDSTGGGKAATTSAGEDVEDIVIN
EARKASQTATEQNPPQESISVYKATPVQVLDESLDSQSNPSLYSLQTTTTNTSDESDTVR
IYDFNKQETTVIRAAPAEQQPSESTTSSMESAQGAPPSVSSSIDSSVSQKRERPVVLQFG
PGDSVPTIGSPASTPTRGSTPPAFRFLQPKRRLIDPSQVLSVDEDDVPEPTTPAAEKPVI
EDEVAHSMPSVKALAQAFLLTSKHTQPQRRWRAKVRIAAPPDTPDKPNTSLAKRHKLEHA
VSMAEVADESTIASDLSSLETDPSIHSEATPPIASPASPVPVRHGFLRSNIAFFENLKFK
Download sequence
Identical sequences A1Z718
NP_001246185.1.81976 NP_788280.1.81976 FBpp0087989 FBpp0297785 FBpp0297789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]