SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088074 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088074
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-26
Family G proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088074   Gene: FBgn0040513   Transcript: FBtr0089002
Sequence length 201
Comment type=protein; loc=2R:complement(3332531..3333022,3333087..3333200); ID=FBpp0088074; name=kappaB-Ras-PA; parent=FBgn0040513,FBtr0089002; dbxref=FlyBase:FBpp0088074,FlyBase_Annotation_IDs:CG1669-PA,GB_protein:AAF59256.1,REFSEQ:NP_610278,GB_protein:AAF59256,FlyMine:FBpp0088074,modMine:FBpp0088074; MD5=38f4c0598dfbf4ed2e340a8d5f9a68c0; length=201; release=r5.30; species=Dmel;
Sequence
MLNAKIGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGAR
ETLRIYDTAGLQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEI
PVVVLANVRARAAPNPVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPM
QTKSTFPQLRQVMQNRQKSEA
Download sequence
Identical sequences B7YZS7 Q9V4L4
FBpp0088074 FBpp0289079 NP_001137613.1.81976 NP_001260770.1.81976 NP_610278.1.81976 FBpp0088074 FBpp0289079 7227.FBpp0289079 FBpp0088074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]