SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088154 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088154
Domain Number 1 Region: 733-1016
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.2e-81
Family Protein kinases, catalytic subunit 0.00000000537
Further Details:      
 
Domain Number 2 Region: 85-259
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-47
Family Ephrin receptor ligand binding domain 0.0000312
Further Details:      
 
Domain Number 3 Region: 386-626
Classification Level Classification E-value
Superfamily Fibronectin type III 4.02e-26
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 287-386,435-445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000134
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088154   Gene: FBgn0025936   Transcript: FBtr0089085
Sequence length 1080
Comment type=protein; loc=4:join(632029..632281,632353..632432,634241..634421,634563..635048,635662..636549,636631..636807,637930..637977,638974..639102,639162..639257,639319..639689,640263..640409,640474..640860); ID=FBpp0088154; name=Eph-PD; parent=FBgn0025936,FBtr0089085; dbxref=GB_protein:AAN06502.1,FlyBase_Annotation_IDs:CG1511-PD,FlyBase:FBpp0088154,GB_protein:AAN06502.2,REFSEQ:NP_726588,GB_protein:AAN06502,FlyMine:FBpp0088154,modMine:FBpp0088154; MD5=0d5755c93ecf30f6f30f6713c83f3e52; length=1080; release=r5.30; species=Dmel;
Sequence
MKMVGCHPNDKKVKYDGIKSKTSSVTILTSVLNDAISALKSAFYKNQAPISEQNRSQIVS
RMSLLRTILLIIISIHFKLAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDF
VKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKET
FSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDINTEVKSIAVNKKGVYF
AFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPYETP
TYLCKGDGKWTILTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVTKCTPCPPNSNASKT
GSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSET
NSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHI
NEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQAEIVFTTESVLLSTVFNLRIL
AITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEY
GFQVRCKTNNGFGSYSNMIYAQTLQSVGSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY
FMRSKHQDDLDKKSTNHLPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPH
TYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPG
SSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKF
QTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDAY
TTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEK
GYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDG
NHILDGQRGQNIFISTDLWLEHIKMSRYCHHFKEANLINAQQVNSSNYHFCINQFFIVKY
Download sequence
Identical sequences Q59DQ4
FBpp0088154 FBpp0088154 NP_726588.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]