SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088195 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088195
Domain Number 1 Region: 84-404
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-48
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 1303-1453
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-17
Family Fibronectin type III 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088195   Gene: FBgn0039904   Transcript: FBtr0089126
Sequence length 1500
Comment type=protein; loc=4:join(381317..381632,382930..383239,383297..383508,383572..383760,384120..384265,384494..385567,386300..387388,390133..390370,390436..390590,391717..391983,392439..392802,392876..393018); ID=FBpp0088195; name=Hcf-PA; parent=FBgn0039904,FBtr0089126; dbxref=FlyBase:FBpp0088195,FlyBase_Annotation_IDs:CG1710-PA,GB_protein:AAF59349.2,REFSEQ:NP_524621,GB_protein:AAF59349,FlyMine:FBpp0088195,modMine:FBpp0088195; MD5=ace81599602c8f0ae6a445a5e359f4a0; length=1500; release=r5.30; species=Dmel;
Sequence
MEGSDFVDPAFSSGERISASDLNSEHIIQAENHSFANRISMDMDVPDGHQLDSNLTGFRW
KRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVP
NGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLG
HSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPP
PRESHTGISFATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLH
SSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVP
RARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTHA
LELSWTATTFAAAYVLQIQKIEQPLNTSSKLLSNNIVQQGTPTSAETSGINISANRSGSA
LGLGVEATSTVLKLEKESLQLSGCQPETNVQPSVNDLLQSMSQPSSPASRADKDPLSSGG
GTTFNLSTSVASVHPQISVISSTAAVTGNDTASPSGAINSILQKFRPVVTAVRTSTTTAV
SIATSTSDPLSVRVPSTMSANVVLSSSSSTLRIVPSVTASHSLRIASSQASGNNCRSSSA
INILKTALPNVAVQSQPTSSTTTSIGGKQYFIQKPLTLAPNVQLQFVKTSGGMTVQTLPK
VNFTASKGTPPHGISIANPHLASGITQIQGSTVPGSQIQKPIVSGNVLKLVSPHTMAGGK
LIMKNSNILQMGKVTPNVMGGKPAFVITNKQGTPLGNQQIIIVTTGGNVRSVPTSTVMTS
AGGSASGTNIVSIVNSTSTTPSPLQALSGQKTLISNQSGVKMLRNISSVQASSSMAFGQK
QSGTPIHQKTALYIGGKAVTVMSTNTSMAASGNKVMVLPGTSSNNSPATTTALSARKSFV
FNAGGSPRTVTLATKSINAKSIPQSQPVTETNNHSVATIKDTDPMDDIIEQLDGAGDLLK
LSESEGQHGSEENENNGENATSSSASALFTGGDTAGPSRAQNPIVMEHPVDIIEDVSGVS
STTDVNETAIVSGDTIESLKMSEKENDDVKSMGEKSILSDDCHQPTTSETEAATILTTIK
SAEALVLETAEIRKDHTGCTIGSLKENQDENKKFKQRQESSPSQNIHQFQNVDGSQLEAL
ASAALLQAATSDTTALALKELIERPESETNTRSSNIAEIQQNNVQSTLAVVVPNTSQNEN
QKWHTVGVFKDLSHTVTSYIDSNCISDSFFDGIDVDNLPDFSKFPRTNLEPGTAYRFRLS
AINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSV
YLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQ
KGYGPATQVRWLQDPAAAKQHTPTVTPNLKRGPEKSTIGSSNIANTFCSPHKRGRNGLHD
Download sequence
Identical sequences Q9V4C8
NP_524621.2.81976 NP_726566.1.81976 NP_995595.1.81976 7227.FBpp0088195 FBpp0088193 FBpp0088194 FBpp0088195 FBpp0089333 FBpp0088193 FBpp0088193 FBpp0088194 FBpp0088195 FBpp0089333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]