SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088202 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088202
Domain Number 1 Region: 141-274
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-40
Family Synaptotagmin-like (S variant) 0.00037
Further Details:      
 
Domain Number 2 Region: 273-320
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000387
Family Synaptotagmin-like (S variant) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088202   Gene: FBgn0039900   Transcript: FBtr0089134
Sequence length 327
Comment type=protein; loc=4:complement(301052..301057,301123..301163,302350..302518,302574..302654,303062..303364,322868..322949,323012..323152,325642..325802); ID=FBpp0088202; name=Syt7-PB; parent=FBgn0039900,FBtr0089134; dbxref=FlyBase_Annotation_IDs:CG2381-PB,FlyBase:FBpp0088202,GB_protein:AAN06523.2,REFSEQ:NP_726558,GB_protein:AAN06523,FlyMine:FBpp0088202,modMine:FBpp0088202; MD5=44ad406055a56eaac88ee9e103fd37cc; length=327; release=r5.30; species=Dmel;
Sequence
MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG
DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
RNLKAKDINGKSDPYVKVWLQFGDKRF
Download sequence
Identical sequences Q6NNV2
FBpp0088202 FBpp0112967 NP_726558.2.81976 FBpp0088202 FBpp0112967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]