SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088355 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0088355
Domain Number - Region: 47-99
Classification Level Classification E-value
Superfamily Histone-fold 0.000279
Family TBP-associated factors, TAFs 0.075
Further Details:      
 
Domain Number - Region: 207-369
Classification Level Classification E-value
Superfamily ARM repeat 0.000656
Family HspBP1 domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088355   Gene: FBgn0014342   Transcript: FBtr0089313
Sequence length 589
Comment type=protein; loc=3R:complement(1374109..1374910,1375315..1375484,1375545..1376342); ID=FBpp0088355; name=mia-PA; parent=FBgn0014342,FBtr0089313; dbxref=GB_protein:AAF52013.2,FlyBase:FBpp0088355,FlyBase_Annotation_IDs:CG10390-PA,GB_protein:AAF52013.3,REFSEQ:NP_649547,GB_protein:AAF52013,FlyMine:FBpp0088355,modMine:FBpp0088355; MD5=4714292a9f2e1cb3d6fe1fd87c606a07; length=589; release=r5.30; species=Dmel;
Sequence
MWQFENKNATKMKTSQNEMPDKDKSFRRHSLSPRSLSAIFFHSTGLHLDDGVAQWLSINV
KEDITNLLNEAGKYMRRIRDRRLQLSHIQHAVRMHDDLCYDIFFRLVHCDDCKMPPSQKV
LKTVREAVTAEKKDELLVSYPESVQESVPEPVPETSLEPPPMHTGWLKVEQVLLKPSKRY
PLSMEQQNFFELVTEACVGDLESRRVLALKAISTDPSLEELLPRLTKFIADAVAINVAQQ
NLPLLLYLMRMVRALLGNQRFSLLQYLHLLLPAVLSCLLAKQVCASPNSEDHWALREYSG
NIMAHIVRQFDAADNGILPRVIGVYNKALLKKPLTTVFGAVIGLGKMGNHAVRACILPQL
KYLSEHIDSHMAASNDSPSSSVDRQAVKYIRHRLMKMCSPVLMGIHQPPDLPEEFMERYG
SLGTLMSDGVTVMRTKKQAVAAAKAEAELKLKNMATEHLNSRGKGSRSVGSNDLVSGTQL
PKNGIRPTSQAPKSVYSISVNGQTVKISTPNLCNTMLQHQKKDLFSKPSDFVVPQLVVNQ
FKNGLIPSNSQRSSSPARNVIHLKPNNDHPSKMALFLRQAITADCPIIT
Download sequence
Identical sequences Q9VND0
FBpp0088355 FBpp0289286 FBpp0088355 NP_001138010.1.81976 NP_001287181.1.81976 NP_649547.3.81976 FBpp0088355 FBpp0289286 7227.FBpp0088355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]