The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0088356 |
| Domain Number 1 |
Region: 213-458 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Metalloproteases ("zincins"), catalytic domain |
4.64e-67 |
| Family |
Leukotriene A4 hydrolase catalytic domain |
0.000000157 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 8-205 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Leukotriene A4 hydrolase N-terminal domain |
7.06e-47 |
| Family |
Leukotriene A4 hydrolase N-terminal domain |
0.0000101 |
| Further Details: |
|
| |
| Domain Number 3 |
Region: 466-612 |
| Classification Level |
Classification |
E-value |
| Superfamily |
ARM repeat |
2.01e-32 |
| Family |
Leukotriene A4 hydrolase C-terminal domain |
0.00051 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Molecular Function |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0088356 Gene: FBgn0032721 Transcript: FBtr0089314 |
| Sequence length |
613 |
| Comment |
type=protein; loc=2L:complement(18855253..18856077,18856143..18856848,18856916..18857064,18857177..18857338); ID=FBpp0088356; name=CG10602-PD; parent=FBgn0032721,FBtr0089314; dbxref=FlyBase:FBpp0088356,FlyBase_Annotation_IDs:CG10602-PD,GB_protein:AAN11017.1,REFSEQ:NP_724140,GB_protein:AAN11017; MD5=87c31d98fb379418d3651328c01d2160; length=613; release=r5.30; species=Dmel; |
| Sequence |
MGRLGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRD
INVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGL
QWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALID
KKEPGKTLFKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLK
TATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWT
GNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKELDFKMLSNLTDLQECIRTQLNKTPE
LTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIET
KDFQSALYDYFIDTDKKDKLSAVDWDLWLKSEGMPPVIPNFDESLANVTKELASLWSSKS
VAELADSAEIKTTISIHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFR
LNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWPEAKPAAIRNFVNVKDQMMA
VCSHTIEKDLGLK
|
| Download sequence |
 |
| Identical sequences |
A4V0U4
FBpp0088356 FBpp0088356 FBpp0088357 FBpp0088358 7298498___KOG1047 NP_724139.1.81976 NP_724140.1.81976 FBpp0088356 FBpp0088357 FBpp0088358 FBpp0300412 |
