SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088356 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088356
Domain Number 1 Region: 213-458
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.64e-67
Family Leukotriene A4 hydrolase catalytic domain 0.000000157
Further Details:      
 
Domain Number 2 Region: 8-205
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 7.06e-47
Family Leukotriene A4 hydrolase N-terminal domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 466-612
Classification Level Classification E-value
Superfamily ARM repeat 2.01e-32
Family Leukotriene A4 hydrolase C-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088356   Gene: FBgn0032721   Transcript: FBtr0089314
Sequence length 613
Comment type=protein; loc=2L:complement(18855253..18856077,18856143..18856848,18856916..18857064,18857177..18857338); ID=FBpp0088356; name=CG10602-PD; parent=FBgn0032721,FBtr0089314; dbxref=FlyBase:FBpp0088356,FlyBase_Annotation_IDs:CG10602-PD,GB_protein:AAN11017.1,REFSEQ:NP_724140,GB_protein:AAN11017; MD5=87c31d98fb379418d3651328c01d2160; length=613; release=r5.30; species=Dmel;
Sequence
MGRLGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRD
INVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGL
QWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALID
KKEPGKTLFKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLK
TATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWT
GNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKELDFKMLSNLTDLQECIRTQLNKTPE
LTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIET
KDFQSALYDYFIDTDKKDKLSAVDWDLWLKSEGMPPVIPNFDESLANVTKELASLWSSKS
VAELADSAEIKTTISIHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFR
LNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWPEAKPAAIRNFVNVKDQMMA
VCSHTIEKDLGLK
Download sequence
Identical sequences A4V0U4
FBpp0088356 FBpp0088356 FBpp0088357 FBpp0088358 FBpp0088356 FBpp0088357 FBpp0088358 FBpp0300412 7298498___KOG1047 NP_724139.1.81976 NP_724140.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]