SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088523 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088523
Domain Number 1 Region: 1561-1796
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.56e-69
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00019
Further Details:      
 
Domain Number 2 Region: 523-683
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.4e-37
Family Group II chaperonin (CCT, TRIC), apical domain 0.00059
Further Details:      
 
Domain Number 3 Region: 182-253
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0039
Further Details:      
 
Domain Number 4 Region: 344-403
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000367
Family DEP domain 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0088523
Domain Number - Region: 481-527,673-694
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00113
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.033
Further Details:      
 
Domain Number - Region: 411-471
Classification Level Classification E-value
Superfamily Stathmin 0.0667
Family Stathmin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088523   Gene: FBgn0028741   Transcript: FBtr0089554
Sequence length 1809
Comment type=protein; loc=2R:complement(13662753..13662940,13662998..13663159,13663222..13663379,13663439..13663601,13663663..13665657,13665718..13667974,13668106..13668612); ID=FBpp0088523; name=fab1-PA; parent=FBgn0028741,FBtr0089554; dbxref=FlyBase_Annotation_IDs:CG6355-PA,FlyBase:FBpp0088523,GB_protein:AAF57789.1,REFSEQ:NP_611269,GB_protein:AAF57789,FlyMine:FBpp0088523,modMine:FBpp0088523; MD5=cf971b2599824765adb102aff767729d; length=1809; release=r5.30; species=Dmel;
Sequence
MTSNNQNNSSSHQHLHSPSKLTEFARNFEDKPESLFGRVVNKIQNVYNQSYNTVNDISSG
SSSSSSTQPVQVVGKSQFFSDSQTSTAEIADVETSSQSSVRPQPPTTLSIRTNSETRGTS
TSSNTAAEDSETSDRVETLPLPTSEANQGRTVSNVLKHISNIVATKNNNDLRNYKDTELQ
RFWMPDSKAKECYDCSQKFSTFRRKHHCRLCGQIFCSKCCNQVVPGMIIRCDGDLKVCNY
CSKIVLTFLKSSSSEMGQDMQELQQHLSNKLEVQDSGSSLAKHPQMQRAPLPRKTSVGYQ
EERFSSHPTYTTLSIDDRKNILQQSNSLITLHEEMQRDLPAQNCGQRLIEFLNSNNKSAN
EVQAVAILNAMLAAGFLEPIVPDPEQMDFDSSLHYKFSKSSSSDTSRTMSPQFEANPHAE
PQPPKSMDQSAEEKEKELENELENDRCYTTATSKLLASYCEHEEQLLAQMLRAHNLDQEW
DKVLQMLCSTAANHFKPEHCSNDLMDIRNYVNFKKVPGGRRKDSKIVHGVAFSKNVAHKD
MATHVPFPRILLLQCPIVYERIEGKFVTIETVLLQEKEYLRNVCARIMSFKPNVVLVHKN
VAGIAQDLLRSYEVTLVLDVKLSVMERLSRTLQCDIVSSIESNITMPKLGYCNDFYIRNY
NGKTLMFFEKLTNPRGYTCLLRGGSNAELTRVKRVASALLFARYNWRLEMSFLLNEFAQP
LSPKPSIFDSKETSPKTETEAELRSKRPIILERKSEDKITTIVSENVSDFTDPLRASQAE
ALSTSPCAPPVVEALAVEPRYDNRFRTALSSTLLSVSPFLTFPLPYLETEQGRKCKLRKL
FPAELYFSKQWSRTGLERPDSMGDGEAGKSEPGNKENQMQLLPAHDFVLMKITAPASSRD
IQSKLAEFRSFGGRLPKGKAPMLRPKKKNAEVIQRPQKVSEEQLYKDALDPQNHQRLPVL
FCSFHYNPKGVSSFCKLPMLLDMKFYGQYDIMLEQFLQRYCCLFNSMCPSCNLPMLGHVR
RYVHSLGCVHVYLTEDLTRSDPTRIYFTSWCSICNATTPTIPLSDAAKCLSLAKYLEMRF
HGHAYKRRPPSTDAEQGGTVCEHSLHRDYVHHFSFRGVGAKFQYTPVEVWETDLPSLTVQ
LDLPQPFQSAQVQEEIKNFSIKGHEVYNRIHERIADLATEEENSPLVQHLKTMLTHDQFI
FKQKIEIVHTLLTDNRATAYDTSDALAMARRALAESIELWGPRLQEIEKLTAKQAHHIDS
GTICTEELRPEQVQTADSSKVTTSSLPKENDPLECPSEDTETGASNSQTVLDKNFSIDQM
LASTVNVYSDKKSIRKILTQLLPSGNQVNPLQSPFPAQDHLTLPLGSIPIHVRETDLSSV
IAYSLTSMDYQKAIDEAEANSNAAHSSPQLKRKIPLAESVSDAEDSPSLSRTSSNTSAAP
NASVPSPATAASESEEKSKERIKQPPSPHITLAFQDHSCQFQCKIYFAREFDAMRSKSLK
PPKLDKSLYRRLEKSKMREELRISQSRTGSEMELVRKPSDVGAPRTTEDDSNQEEDARIA
LARSLCKSVQWEARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQ
QQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLFYGCNIENKFDLKGSERNRLVDPSNQ
QGEIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGLDKKNG
VLVLGIIDYIRTFTLDKRVESIIKGSGILGGKGKDPTVVNPERYKQRFIDAMDRYFLTVP
DRWEGLSKV
Download sequence
Identical sequences C7LAB6 O96838
FBpp0088523 FBpp0088952 NP_611269.1.81976 NP_995880.1.81976 7227.FBpp0088523 FBpp0088523 FBpp0088952 FBpp0088523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]