SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088544 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088544
Domain Number 1 Region: 988-1100
Classification Level Classification E-value
Superfamily ARID-like 1.06e-32
Family ARID domain 0.0000544
Further Details:      
 
Domain Number 2 Region: 2321-2492
Classification Level Classification E-value
Superfamily ARM repeat 0.00000791
Family HspBP1 domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088544   Gene: FBgn0261885   Transcript: FBtr0089582
Sequence length 2703
Comment type=protein; loc=3R:complement(13515540..13519177,13519246..13519327,13519437..13519635,13519858..13520017,13520556..13521035,13521645..13521833,13522092..13522308,13523387..13523638,13523703..13523884,13523952..13524686,13524817..13525209,13525269..13525425,13533493..13533711,13533776..13534069,13541574..13542488); ID=FBpp0088544; name=osa-PA; parent=FBgn0261885,FBtr0089582; dbxref=FlyBase:FBpp0088544,FlyBase_Annotation_IDs:CG7467-PA,GB_protein:AAF55457.1,REFSEQ:NP_732263,GB_protein:AAF55457,FlyMine:FBpp0088544,modMine:FBpp0088544; MD5=1670018a2eee23e7eab0ccf1c0b9dc78; length=2703; release=r5.30; species=Dmel;
Sequence
MNEKIKSPQTQQQQQGGAPAPAATPPSAGAAPGAATPPTSGPPTPNNNSNNGSDPSIQQQ
QQNVAPHPYGAPPPPGSGPGGPPGPDPAAVMHYHHLHQQQQQHPPPPHMQQQQHHGGPAP
PPPGGAPEHAPGVKEEYTHLPPPHPHPAYGRYHADPNMDPYRYGQPLPGGKPPQQQQPHP
QQQPPQQPGPGGSPNRPPQQRYIPGQPPQGPTPTLNSLLQSSNPPPPPQHRYANTYDPQQ
AAASAAAAAAAQQQQAGGPPPPGHGPPPPQHQPSPYGGQQGGWAPPPRPYSPQLGPSQQY
RTPPPTNTSRGQSPYPPAHGQNSGSYPSSPQQQQQQQQQQQQQAGQQPGGPVPGGPPPGT
GQQPPQQNTPPTSQYSPYPQRYPTPPGLPAGGSNHRTAYSTHQYPEPNRPWPGGSSPSPG
SGHPLPPASPHHVPPLQQQPPPPPHVSAGGPPPSSSPGHAPSPSPQPSQASPSPHQELIG
QNSNDSSSGGAHSGMGSGPPGTPNPQQVMRPTPSPTGSSGSRSMSPAVAQNHPISRPASN
QSSSGGPMQQPPVGAGGPPPMPPHPGMPGGPPQQQQSQQQQASNSASSASNSPQQTPPPA
PPPNQGMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPG
NYPPRPQYPPGAYATGPPPPPTSQAGAGGANSMPSGAQAGGYPGRGMPNHTGQYPPYQWV
PPSPQQTVPGGAPGGAMVGNHVQGKGTPPPPVVGGPPPPQGSGSPRPLNYLKQHLQHKGG
YGGSPTPPQGPQGYGNGPTGMHPGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQP
QGQGASGGPESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLS
NASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPR
PAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTP
ITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYT
KNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPGSSNSQDSFPAPPGSAPNA
AIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAAAAVAAGDNISVSN
PFEDPIAAGGGPGSGTGPGPGQGPGPGAASGGAGAVGAVGGGPQPHPPPPHSPHTAAQQA
AGQHQQQHPQHQHPGLPGPPPPQQQQGQQGQQPPPSVGGGPPPAPQQHGPGQVPPSPQQH
VRPAAGAPYPPGGSGYPTPVSRTPGSPYPSQPGAYGQYGSSDQYNATGPPGQPFGQGPGQ
YPPQNRNMYPPYGPEGEAPPTGANQYGPYGSRPYSQPPPGGPQPPTQTVAGGPPAGGAPG
APPSSAYPTGRPSQQDYYQPPPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSGTQQ
YRPQYPSSPAPQNWGGAPPRGAAPPPGAPHGPPIQQPAGVAQWDQHRYPPQQGPPPPPQQ
QQQPQQQQQQPPYQQVAGPPGQQPPQAPPQWAQMNPGQTAQSGIAPPGSPLRPPSGPGQQ
NRMPGMPAQQQQSQQQGGVPQPPPQQASHGGVPSPGLPQVGPGGMVKPPYAMPPPPSQGV
GQQVGQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQMPPNQTA
PGGYGPPGMPGGGAQLVKKELIFPHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRS
GLLTECTWALDVLNVLLFDDSTVQFFGISNLPGLLTLLLEHFQKNLAEMFDERENEEQSA
LLAEDADDDADSGTVMCEKLRTSGRQPRCVRSISSYNRRRHYENMDRSGKDGAGNGSDSE
DADEGIDLGQVRVQPNPEERSLLLSFTPNYTMVTRKGVPVRIQPAENDIFVDERQKAWDI
DTNRLYEQLEPVGSDAWTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKKGRKRTELA
SSSRKPEIKTEENSTEEQTFNKKRRLVSGGSSSSGAHAEGKKSKLTSEEFAQPNAEVKKE
PGTADSDCRPVDMDIEAPQQRLTNGVAPCSSTPAIFDPRTTAKDEARVLQRRRDSSFEDE
CYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLN
HEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELS
RYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDL
VIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVALQSPCISY
LVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQ
QEQRLLGLVMSHILDQQVALIISRVLYQVSRGTGPIHSVEFRLLQQRQQQQLRPGPAGKQ
AASAGGSATVKAETASTETSSTEAKPAPAATTAVVNDENSNSSQQLPPAATFNDVSNSST
NSNSCGTASSNQTNNSTTNSSHSSSAISSQSAITVAAPSAAATGAGSATAAAIASDQQQV
SKVAAAAAAAAALSNASAAAAAAAAAAAASVGPPTSSSVSAGAAVAQPAAPPPTNAGTTT
AVA
Download sequence
Identical sequences FBpp0088544 FBpp0088544 NP_732263.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]