The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0088692 |
Domain Number 1 |
Region: 3-142 |
Classification Level |
Classification |
E-value |
Superfamily |
ENTH/VHS domain |
1.03e-39 |
Family |
VHS domain |
0.000000192 |
Further Details: |
|
|
Domain Number 2 |
Region: 158-220 |
Classification Level |
Classification |
E-value |
Superfamily |
FYVE/PHD zinc finger |
2.25e-20 |
Family |
FYVE, a phosphatidylinositol-3-phosphate binding domain |
0.000026 |
Further Details: |
|
|
Sequence: |
FBpp0088692 |
Domain Number - |
Region: 415-497 |
Classification Level |
Classification |
E-value |
Superfamily |
BAR/IMD domain-like |
0.0732 |
Family |
Arfaptin, Rac-binding fragment |
0.064 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Biological Process |
IC (bits) |
H-Score |
Molecular Function |
IC (bits) |
H-Score |
Cellular Component |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0088692 Gene: FBgn0031450 Transcript: FBtr0089751 |
Sequence length |
760 |
Comment |
type=protein; loc=2L:join(2740181..2740211,2740389..2740473,2740520..2740784,2741108..2741482,2741559..2743085); ID=FBpp0088692; name=Hrs-PC; parent=FBgn0031450,FBtr0089751; dbxref=FlyBase:FBpp0088692,FlyBase_Annotation_IDs:CG2903-PC,GB_protein:AAN10412.2,REFSEQ:NP_722830,GB_protein:AAN10412; MD5=edb38649418e4b98480e70434667e42a; length=760; release=r5.30; species=Dmel; |
Sequence |
MFRSSFDKNLENATSHLRLEPDWPSILLICDEINQKDVTPKNAFAAIKKKMNSPNPHSSC
YSLLVLESIVKNCGAPVHEEVFTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSS
DKYQAIKDTMTILKAKGHTFPELREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHC
RNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSGGAKSGPRPADSELPA
EYLNSTLAQQVQTPARKTEQELKEEEELQLALALSQSEAEQQKPKLQSLPPAAYRMQQRS
PSPEAPPEPKEYHQQPEEATNPELAKYLNRSYWEQRKISESSSMASPSAPSPMPPTPQPQ
QIMPLQVKSADEVQIDEFAANMRTQVEIFVNRMKSNSSRGRSISNDSSVQTLFMTLTSLH
SQQLSYIKEMDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLRRIAEEQERQRQMQM
AQKLDIMRKKKQEYLQYQRQLALQRIQEQEREMQLRQEQQKAQYLMGQSAPPFPYMPPSA
VPQHGSPSHQLNNVYNPYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMPPNL
QPGGLMQQPAPPGNPQMMPPMPENQFANNPAAILQLPQQHSIAQPPQIPFQPQPQQIPGQ
QPQQIPGQQPQQIPGQQPQQIPGQQPQQIPVQQPQPQPQMGHVMLQQHQAPPAAQAPPVT
EIANNQVQAVAAAPAPPQNEPGPAPVKAEEPATAELISFD
|
Download sequence |
 |
Identical sequences |
B7FNJ7 Q960X8
NP_525099.3.81976 NP_722830.2.81976 7227.FBpp0088692 FBpp0088691 FBpp0088692 FBpp0088691 FBpp0088692 FBpp0088690 |