SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088728 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088728
Domain Number 1 Region: 767-896
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 736-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 935-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000911
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 4 Region: 889-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0088728
Domain Number - Region: 697-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000382
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088728   Gene: FBgn0051665   Transcript: FBtr0089787
Sequence length 1115
Comment type=protein; loc=2L:join(1842999..1844720,1848065..1848213,1851110..1851273,1851692..1851964,1852054..1852150,1852658..1852785,1853454..1853596,1854186..1854308,1855364..1855797,1856430..1856544); ID=FBpp0088728; name=CG31665-PA; parent=FBgn0051665,FBtr0089787; dbxref=GB_protein:AAF51334,FlyBase:FBpp0088728,FlyBase_Annotation_IDs:CG31665-PA,GB_protein:AAF51334.2,REFSEQ:NP_722737,GB_protein:AAF51334,FlyMine:FBpp0088728,modMine:FBpp0088728; MD5=475ef83419f468eb45fd02b6921c6137; length=1115; release=r5.30; species=Dmel;
Sequence
MWKIYVLTLVIAVVAATTSETITNDLTAKSNRTLLKTSTEESREISALGGSTSTATPTTT
ATTSTTTTRATTVAEDEMEETSTPTPTTVRLMTTTQKMVQANLGEIGSIKDALHRIKLSE
KPVDGATTTTEQPEAMDQDEQDEQDVTPTISPLQIQMQAAASYQVAETLADLNEEERARY
DAMLAQQPTASKLNIVDLYPLKIEDIQPIIRNDNDELIKQRTVFTQHENAEEYKQNLMPN
EVEMMVDKEVIEMKDKIQINQEKFGSSTTVKPTTSRPHQGTTADFTGKLLADQDDLITEI
ESKFQLHETTTLRPRVTTVQHPGNTFIDRRVKKSFEFPMQHRASDVMAMPHIDFANTKFQ
TDADAPNPPASHPEFSTTKFYNSKELYNEMLLHNKRKLMKAAKAEGSPIKSAEDTTRATS
SNVTPEGKTFGPTTTTAAGSTATTTAESTTTAATTTRLPATTTGKYQKELKRAKLLLKAL
TPPKSVDKSTASPSSTTSTSTSTTTTMATLLATARTRPSAANPTKTASKPIARPRILSRL
QEKINSLECEIPNVPQDSHLWRGNETHELLLPIVTTEHCKPDEHCVPNVLTWRGEAEIQS
GDILIVEINDAMLNPSHEPNNTSSAVHATQVYQVTRSGHEHCDVTEGVLLDITPLVVDGR
KLVTLYDKDLTEGVNLLIVVSELWGAQCVRLKVTTKTDNCGENADCSGKGVCYSNSGMEE
YECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYES
DPCNPAECMNGGSCVGNSTHFRCDCAPGFTGPLCQHSLNECESSPCVHGICVDQEDGFRC
FCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKP
CPEGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYFQQCNVNPCTHGGTCWSSGDSFYCAC
RPGYTGTMCEGELPGALCFRCPKVINLIRDISVARRKYVSPGGYLTFSGDFFPAFPQMSS
WWRRSLVPANLLWTMRTPEILMTKLSVHRLCLRVPLNCIMHILRPESWQPQFSSLPLWSP
FVTARSIRLIENSPHVPPRLYPYWASVAARKCRAN
Download sequence
Identical sequences FBpp0088728 FBpp0088728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]