The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Cellular Component |
IC (bits) |
H-Score |
Biological Process |
IC (bits) |
H-Score |
Molecular Function |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0088903 Gene: FBgn0003721 Transcript: FBtr0089964 |
Sequence length |
285 |
Comment |
type=protein; loc=3R:join(11110371..11110484,11110951..11111076,11120835..11120968,11122313..11122430,11124999..11125069,11126469..11126544,11126733..11126795,11128875..11128944,11133312..11133397); ID=FBpp0088903; name=Tm1-PG; parent=FBgn0003721,FBtr0089964; dbxref=FlyBase:FBpp0088903,FlyBase_Annotation_IDs:CG4898-PG,GB_protein:AAN13645.1,REFSEQ:NP_732003,GB_protein:AAN13645,FlyMine:FBpp0088903,modMine:FBpp0088903; MD5=d1bd58705cf8b391dd8e4fb971f7ea6d; length=285; release=r5.30; species=Dmel; |
Sequence |
MDAIKKKMQAMKVDKDGALERALVCEQEARDANTRAEKAEEEARQLQKKIQTVENELDQT
QEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAA
DESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAE
FAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELILKE
|
Download sequence |
|
Identical sequences |
A0A0P8XLC8 A0A0Q9WUR1 A0A1W4VPE1 I5APU5
FBpp0088903 FBpp0088906 FBpp0291171 FBpp0296934 FBpp0088903 FBpp0088906 FBpp0291171 NP_732001.3.81976 NP_732002.1.81976 NP_732003.1.81976 NP_732004.1.81976 XP_003736907.1.19638 XP_014760064.1.52611 XP_015032398.1.14588 XP_016034581.1.80810 XP_016034593.1.80810 XP_016960191.1.21709 XP_017053717.1.74164 XP_017067739.1.81094 XP_017091742.1.53830 XP_017130691.1.32376 XP_017141542.1.22881 XP_017846596.1.30616 |