SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089025 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089025
Domain Number 1 Region: 331-660
Classification Level Classification E-value
Superfamily Subtilisin-like 7.59e-93
Family Subtilases 0.000000000445
Further Details:      
 
Domain Number 2 Region: 654-792
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.74e-37
Family Proprotein convertase P-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 231-302
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.21e-22
Family Prohormone convertase 1 pro-domain 0.001
Further Details:      
 
Domain Number 4 Region: 847-878,946-972
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000175
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089025   Gene: FBgn0004509   Transcript: FBtr0089982
Sequence length 1101
Comment type=protein; loc=3R:complement(21173325..21174061,21177839..21177914,21179871..21180037,21181946..21182064,21182119..21182292,21182356..21183230,21183294..21183422,21183593..21183838,21222434..21223216); ID=FBpp0089025; name=Fur1-PA; parent=FBgn0004509,FBtr0089982; dbxref=FlyBase:FBpp0089025,FlyBase_Annotation_IDs:CG10772-PA,GB_protein:AAN14051.1,REFSEQ:NP_733102,GB_protein:AAN14051,FlyMine:FBpp0089025,modMine:FBpp0089025; MD5=c38241789540d23e762383fd43b53dce; length=1101; release=r5.30; species=Dmel;
Sequence
MKNDVVRWSRQPTSNTTNSSSSSRSDSNSTHKHRSKSNKLNARQLGSNAARSCQQRSSVA
TTLEDEQQTIIECDIGNFNFDCNLFKTSFLTQHKQKRSGKSSSKSKSNRSRPLAKTKAVF
LLALQFSAVVFLCNINVGFVAGSVATAASSAGGSSPAAPSSAPSSPPTVAVPPPPPPSSA
LKVDPNGQSPVLPPYVLDYETGGKAKLTPNNGKFGQSGSSGSNNNHIVGHYTHTWAVHIP
NGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQ
QRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLDMNVIPAWKMG
ITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGE
VAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGK
TVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSAT
EEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALV
LQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNW
KAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCRSVNYLEHVQAKITLTSQRRGDIQL
FLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMAQITQ
WDMIFYGTETPAQPDDVANPSQSNQFNLYGNDMAHNDVEYDSTGQWRNMQQVGEVGMTRD
HSNTAACLKWSDRKCLECNDSAYMFEDQCYDVCPVHTYPLDKFQAEEDEQDDEVTRGPVN
PYSSSPMDHSLLMSNSLDDKQDPLQAEDRRRRSSLTQLVEVPSRVCAACDRSCLECYGAL
ASQCSTCSPGSQLRKILNETFCYAYVVRSTGMASVVDISKMDDRDTQQYMTGTTVLLLVS
VIFTLMGVAVAGGIVYHRRAMARSNELYSRVSLVPGDESDSDEDELFTAHFPARKSGVNI
YRDEAPSEKIFEEDEISHLVP
Download sequence
Identical sequences P30430
FBpp0089025 FBpp0089025 NP_733102.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]