SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089026 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089026
Domain Number 1 Region: 331-660
Classification Level Classification E-value
Superfamily Subtilisin-like 9.82e-93
Family Subtilases 0.000000000445
Further Details:      
 
Domain Number 2 Region: 654-792
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-38
Family Proprotein convertase P-domain 0.00017
Further Details:      
 
Domain Number 3 Region: 231-302
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.55e-22
Family Prohormone convertase 1 pro-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089026   Gene: FBgn0004509   Transcript: FBtr0089983
Sequence length 1269
Comment type=protein; loc=3R:complement(21177729..21177914,21179871..21180037,21180670..21181800,21181946..21182064,21182119..21182292,21182356..21183230,21183294..21183422,21183593..21183838,21222434..21223216); ID=FBpp0089026; name=Fur1-PB; parent=FBgn0004509,FBtr0089983; dbxref=FlyBase:FBpp0089026,FlyBase_Annotation_IDs:CG10772-PB,GB_protein:AAF56464.1,REFSEQ:NP_524885,GB_protein:AAF56464,FlyMine:FBpp0089026,modMine:FBpp0089026; MD5=4d02bbb3013a31a2bc716f4011ab8648; length=1269; release=r5.30; species=Dmel;
Sequence
MKNDVVRWSRQPTSNTTNSSSSSRSDSNSTHKHRSKSNKLNARQLGSNAARSCQQRSSVA
TTLEDEQQTIIECDIGNFNFDCNLFKTSFLTQHKQKRSGKSSSKSKSNRSRPLAKTKAVF
LLALQFSAVVFLCNINVGFVAGSVATAASSAGGSSPAAPSSAPSSPPTVAVPPPPPPSSA
LKVDPNGQSPVLPPYVLDYETGGKAKLTPNNGKFGQSGSSGSNNNHIVGHYTHTWAVHIP
NGDNGMADAVAKDHGFVNLGKIFDDHYHFAHHKVSKRSLSPATHHQTRLDDDDRVHWAKQ
QRAKSRSKRDFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLDMNVIPAWKMG
ITGKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGE
VAATANNSFCAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGK
TVDGPGELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSAT
EEGHVPWYSEKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALV
LQSNQNLTWRDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNW
KAVPEQQRCEINAPHVDKVIPPRTHITLQLTVNHCRSVNYLEHVQAKITLTSQRRGDIQL
FLRSPANTSVTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMGHALL
REWSLIFYGTTQSIGPNDPISVPKPSGSEATTPNSSSTTSNLHQAYSPQYPRIPPNNFGS
SPSGGSKLPLGKVPPPNKSSYVTNNPLLNSAPPKQGYQQISATYGVILGKANGKSNNNSK
EKTNNKGNKSNNGNKGKSGGSSGNRKEQTTQSTIIQTSTSKNKYYRISQQQQQKNNKQDR
NGVQTQRPKANSGEKSYDEKSRKVVGEITTNSGNGSIKAAKQVKESTTTSSNSRIPKLFE
RYEKIQAIFPELEPYENSSPKGKPKQAKQGKQFEVDLFKPTNGGNSRQGNTKKSPSVPPP
SQTMATLSILPILPAGGSSFLPDQKILKKQQLLMAAAGVMAPAQVEVEMEEVHATPDYEA
RKDQRKEVNGPNAQITQWDMIFYGTETPAQPDDVANPSQSNQFNLYGNDMAHNDVEYDST
GQWRNMQQVGEVGMTRDHSNTAACLKWSDRKCLGLSLLFFMIMQVFFLNFKHANDNNNKN
KNNIIKCIR
Download sequence
Identical sequences P26016
NP_524885.1.81976 FBpp0089026 7227.FBpp0089026 FBpp0089026 FBpp0089025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]