SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089265 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089265
Domain Number 1 Region: 231-310
Classification Level Classification E-value
Superfamily TPR-like 0.0000205
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0089265
Domain Number - Region: 140-212
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0654
Family MW0975(SA0943)-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089265   Gene: FBgn0041147   Transcript: FBtr0073161
Sequence length 705
Comment type=protein; loc=3L:3905635..3907752; ID=FBpp0089265; name=ida-PB; parent=FBgn0041147,FBtr0073161; dbxref=FlyBase:FBpp0089265,FlyBase_Annotation_IDs:CG10850-PB,GB_protein:AAS64965.1,REFSEQ:NP_995995,GB_protein:AAS64965,FlyMine:FBpp0089265,modMine:FBpp0089265; MD5=e93141b0758b7a69fde0101b34ff69c6; length=705; release=r5.30; species=Dmel;
Sequence
MRTQRRRMFYMLVFKLIQEQDKSYNELHSLLTTGKYKLDTLMLESFEKAMSEFCAGSIEA
LFDFSEIQNIDEILNENYGISQFSMVGVYVRRVGVVLERLSFPEMMDMYKNVCSYYERGV
RAAASGSRMAVAGGILHREETPPPNPITEKPEDPKPKKKVEAVARIAQERNPLSKWAPKQ
AKFFINKQSELLENNERKALPPLELQKKVQEIIHDLPLTTTPYFLGYMNQLRVRDYYNAL
SALHRALDRSPVRLMSQEKGYQYFCVNLAVLHATFGHRDEALAALRESIMLAQEHGDKRS
LNLANTWYCLLRDELPLSAVQKSVQDANEVDGSLLQNYTLALHFAVKLGTVAGYQPLRLF
DLLQHSDNLTNRNNFADHASEALALRSAVWSAYGRHELAALYSQVLLTGRDRFGSGSAGL
GSALASFALWLQLQGEPQLSKVLLHHAKQRFPRLPSAEGWMISQCHVVIQAGIYQCRWHD
ALKACDQLYLIDPSDSLFQRASIYVAKREFFNARRLLDKLAVQDNIPFLLRMRVQVLLGY
CGMANGRFSSETTMLLLRVSEEMSEAQMDYELALVDLLLALQLLLLGMPQKAYQAIKRCM
HDIHINGGLYERAKTDFVFVRCLLAVNQNDAEKRKAQLLKSQVILQRAAQSFKKLSAHAK
VLDVYVFLAQRFNEFGDRNLRNKYAGEFRRYFTDHPIPREYLGSP
Download sequence
Identical sequences FBpp0089265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]