SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089357 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089357
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily POZ domain 2.2e-28
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 569-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000579
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0089357
Domain Number - Region: 539-580
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.021
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089357   Gene: FBgn0004652   Transcript: FBtr0083650
Sequence length 705
Comment type=protein; loc=3R:complement(14248360..14248904,14256554..14256686,14258286..14258540,14259957..14260784,14261092..14261292,14261365..14261512,14303786..14303793); ID=FBpp0089357; name=fru-PK; parent=FBgn0004652,FBtr0083650; dbxref=FlyBase:FBpp0089357,FlyBase_Annotation_IDs:CG14307-PK,GB_protein:AAS65172.1,REFSEQ:NP_996236,GB_protein:AAS65172,FlyMine:FBpp0089357,modMine:FBpp0089357; MD5=f569d22a6930f9ca266489c6b6cf73c4; length=705; release=r5.30; species=Dmel;
Sequence
MTRYNTDQGAMDQQFCLRWNNHPTNLTGVLTSLLQREALCDVTLACEGETVKAHQTILSA
CSPYFETIFLQNQHPHPIIYLKDVRYSEMRSLLDFMYKGEVNVGQSSLPMFLKTAESLQV
RGLTDNNNLNYRSDCDKLRDSAASSPTGRGPSNYTGGLGGAGGVADAMRESRDSLRSRCE
RDLRDELTQRSSSSMSERSSAAAAAAAAAAAVAAAGGNVNAAAVALGLTTPTGGERSPSV
GSASAAAAAAAVAAAVAAAANRSASADGCSDRGSERGTLERTDSRDDLLQLDYSNKDNNN
SNSSSTGGNNNNNNNNNNNSSSNNNNSSSNRERNNSGERERERERERERDRDRELSTTPV
EQLSSSKRRRKNSSSNCDNSLSSSHQDRHYPQDSQANFKSSPVPKTGGSTSESEDAGGRH
DSPLSMTTSVHLGGGGGNVGAASALSGLSQSLSIKQELMDAQQQQQHREHHVALPPDYLP
SAALKLHAEDMSTLLTQHALQAADARDEHNDAKQLQLDQTDNIDGSKAWHMRLTFERLSG
GCNLHRCKLCGKVVTHIRNHYHVHFPGRFECPLCRATYTRSDNLRTHCKFKHPMYNPDTR
KFDNLMSSSAVGAAATPTASQLAVASQAAMAAAAAAAFNAAQQQQQQQQQQQQHQHQQQQ
QHQQSQQQQQQQQQSQQQLHALAQQHMLQLQPQHHQQQQHNATSE
Download sequence
Identical sequences FBpp0089357 FBpp0089357 NP_996236.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]