SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099414 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0099414
Domain Number - Region: 64-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000201
Family Growth factor receptor domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099414   Gene: FBgn0054003   Transcript: FBtr0100058
Sequence length 122
Comment type=protein; loc=2L:complement(13967487..13967694,13967751..13967911); ID=FBpp0099414; name=nimB3-PA; parent=FBgn0054003,FBtr0100058; dbxref=FlyBase:FBpp0099414,FlyBase_Annotation_IDs:CG34003-PA,GB_protein:ABC65899.1,REFSEQ:NP_001033905,GB_protein:ABC65899,FlyMine:FBpp0099414,modMine:FBpp0099414; MD5=7a302be55f068c5b594ad20f95829d02; length=122; release=r5.30; species=Dmel;
Sequence
MHLTSTLIGLLICGLGIELPTRTAAQFWSVDPVTQWRKEALAERGSGICYRTLTVETINP
NSRNRQFSYCCDGYVNKGTSQNLKCEPICSEDCSNGLCLAPEECECAPGYYRSNKRCRFV
LE
Download sequence
Identical sequences Q2PDU0
FBpp0099414 FBpp0099414 FBpp0099414 NP_001033905.1.81976 7227.FBpp0099414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]