SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099671 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099671
Domain Number 1 Region: 265-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-53
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Weak hits

Sequence:  FBpp0099671
Domain Number - Region: 521-591
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000133
Family Tandem AAA-ATPase domain 0.029
Further Details:      
 
Domain Number - Region: 182-227
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0004
Family ComEA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099671   Gene: FBgn0032157   Transcript: FBtr0100279
Sequence length 664
Comment type=protein; loc=2L:complement(9909837..9910226,9910286..9910432,9910489..9910756,9910817..9911149,9911209..9911771,9912125..9912285,9912344..9912476); ID=FBpp0099671; name=CG5899-PB; parent=FBgn0032157,FBtr0100279; dbxref=FlyBase_Annotation_IDs:CG5899-PB,FlyBase:FBpp0099671,GB_protein:ABC65887.1,REFSEQ:NP_001033889,GB_protein:ABC65887,FlyMine:FBpp0099671,modMine:FBpp0099671; MD5=b806b2dbf432837df956da0add4bcbc7; length=664; release=r5.30; species=Dmel;
Sequence
MSDSTVAASASASASSSAKSSLSDLRQFRINKNASSVVASPSRTERVPGKKRIQVMADSD
SDGNDSQTPKKTKLELTVKEKEERYMAAAKISPHFDTMAIQESLSRTNWDVAASVRYLRE
NCKPKGHNGPLAKSKLKPRSNGISGGNFSDNDHSDDDDVKQSKDQVYDSDDSDSEMSTKM
TGQRKKVFQFMNEASLIELQSVKTLSEKKALAIIDVRPFSDWSDLRQKLESIRMSGDLLN
YAQELINKQNTVAAILSKCNNMVSRLEKAISNGAGIVEQPKLLSSGLQLADYQIIGLNWL
TVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENGLSQAAHLIVVPSSTLDNWEAEISRW
CPELVVEKYHGSQDERRRMRGRFAKDGFTGFDVLLTTYHIVGSTPEERKMFRVCKLDYVI
FDEAHMLKNMTTQRYANLITINARMRILLTGTPLQNNLLELISLLCFVMPKFFAKSIEDI
KSLFAKKGKSDGDQDEVSQFQETQIQRAKRIMKPFVLRRLKKDVLKNLPKKLSLVEKVPM
SSQQKIYYHELVDYYSNNKGEVCSSSERAGIAIMMEMRRIANHPLLMRHYFTDANLRGFS
KRLANASSFKKTNEQYIFEELAVMSDFQVYQMMNKHVSDYQRGCPMTMTKFVHLSGVLRR
ENTR
Download sequence
Identical sequences FBpp0099671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]