SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099672 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099672
Domain Number 1 Region: 508-581,631-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-59
Family Tandem AAA-ATPase domain 0.00012
Further Details:      
 
Domain Number 2 Region: 252-506
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-53
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Weak hits

Sequence:  FBpp0099672
Domain Number - Region: 169-214
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000534
Family ComEA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099672   Gene: FBgn0032157   Transcript: FBtr0100280
Sequence length 831
Comment type=protein; loc=2L:complement(9909239..9909865,9909924..9910226,9910286..9910432,9910489..9910756,9910817..9911149,9911209..9911771,9912125..9912379); ID=FBpp0099672; name=CG5899-PC; parent=FBgn0032157,FBtr0100280; dbxref=FlyBase_Annotation_IDs:CG5899-PC,FlyBase:FBpp0099672,GB_protein:ABC65886.1,REFSEQ:NP_001033890,GB_protein:ABC65886,FlyMine:FBpp0099672,modMine:FBpp0099672; MD5=b060497009dfe7f05ca099dc41964a66; length=831; release=r5.30; species=Dmel;
Sequence
MLPLSSLVLRELVLAELKFQAIDTVANCLISERVPGKKRIQVMADSDSDGNDSQTPKKTK
LELTVKEKEERYMAAAKISPHFDTMAIQESLSRTNWDVAASVRYLRENCKPKGHNGPLAK
SKLKPRSNGISGGNFSDNDHSDDDDVKQSKDQVYDSDDSDSEMSTKMTGQRKKVFQFMNE
ASLIELQSVKTLSEKKALAIIDVRPFSDWSDLRQKLESIRMSGDLLNYAQELINKQNTVA
AILSKCNNMVSRLEKAISNGAGIVEQPKLLSSGLQLADYQIIGLNWLTVMHKQEMNGILA
DEMGLGKTIQVIAFLAYLKENGLSQAAHLIVVPSSTLDNWEAEISRWCPELVVEKYHGSQ
DERRRMRGRFAKDGFTGFDVLLTTYHIVGSTPEERKMFRVCKLDYVIFDEAHMLKNMTTQ
RYANLITINARMRILLTGTPLQNNLLELISLLCFVMPKFFAKSIEDIKSLFAKKGKSDGD
QDEVSQFQETQIQRAKRIMKPFVLRRLKKDVLKNLPKKLSLVEKVPMSSQQKIYYHELVD
YYSNNKGEVCSSSERAGIAIMMEMRRIANHPLLMRHYFTDANLRGFSKRLANASSFKKTN
EQYIFEELAVMSDFQVYQMMNKHEFYDVKIPDNLICDSGKFLYLDTLLPKLKAEGHRVLL
FSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDLITDFNGDDSIFVFLLSTKAGGVG
INLTAADTCVIHDIDFNPYNDKQAEDRCHRMGQQRPVTIYRLISESTIEEGILMAAEEKL
KLEKDITSNEKGEVHEQRCVVKLLTTALGLDKDQEEQLNNSLNNSIASPAK
Download sequence
Identical sequences FBpp0099672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]