SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099720 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099720
Domain Number 1 Region: 2367-2593
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-40
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 2619-2827
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.98e-34
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 3 Region: 1853-1979
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-30
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 1412-1518
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 744-853
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 1622-1752
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.00034
Further Details:      
 
Domain Number 7 Region: 1066-1192
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 961-1071
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-22
Family Cadherin 0.00088
Further Details:      
 
Domain Number 9 Region: 1512-1634
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-20
Family Cadherin 0.0006
Further Details:      
 
Domain Number 10 Region: 1296-1400
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 847-968
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 12 Region: 647-756
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-16
Family Cadherin 0.0054
Further Details:      
 
Domain Number 13 Region: 1176-1307
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.004
Further Details:      
 
Domain Number 14 Region: 1958-2094
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000214
Family Cadherin 0.0019
Further Details:      
 
Domain Number 15 Region: 531-625
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000614
Family Cadherin 0.0056
Further Details:      
 
Domain Number 16 Region: 204-305
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000121
Family Cadherin 0.0032
Further Details:      
 
Domain Number 17 Region: 1740-1854
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000006
Family Cadherin 0.0045
Further Details:      
 
Domain Number 18 Region: 2604-2636,2831-2905
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000439
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 19 Region: 2080-2178
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.01
Further Details:      
 
Domain Number 20 Region: 293-415
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000257
Family Cadherin 0.01
Further Details:      
 
Domain Number 21 Region: 476-546
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000557
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099720   Gene: FBgn0015609   Transcript: FBtr0100315
Sequence length 3100
Comment type=protein; loc=2L:complement(17650384..17650505,17650983..17651153,17651279..17651491,17652667..17652905,17657063..17657233,17657313..17659614,17660956..17662279,17664087..17664224,17666612..17666776,17667702..17667817,17667967..17668110,17708034..17708220,17709439..17709621,17711220..17711409,17715723..17715913,17716678..17716689,17717843..17718034,17718094..17718327,17718916..17719701,17719925..17720141,17720654..17721104,17737964..17739518); ID=FBpp0099720; name=CadN-PK; parent=FBgn0015609,FBtr0100315; dbxref=FlyBase_Annotation_IDs:CG7100-PK,FlyBase:FBpp0099720,GB_protein:AAZ66475.1,REFSEQ:NP_001027278,GB_protein:AAZ66475,FlyMine:FBpp0099720,modMine:FBpp0099720; MD5=6ffb7c18ae181f4a1161a2d634056dda; length=3100; release=r5.30; species=Dmel;
Sequence
MAARRCLNQLRQRYITNRFNICTCAIFLISLPFILAIEETTFAGLSAENAARMLAGSPGD
VEKSSLSHHSEMSLVLPHDTYPGFSIKKFKTHPVKINGSSHSGAAAYHMLDTDYSKYFTV
LEDGVVMTTADISPLVNRPVQLVVVEQTPNATNTHNLQLFVMHRNDMLRFSGSLLDASGE
VRENQPAGTRVRGVPLMQAFSGSILDEELATPKKVRYTIIDGNVDDAFALQERKANKNIQ
ISAKSLVINGDDESGVWLVTNRPLDREERAHYDLSVEASDVDGLDRTVSKIQITVLDEND
NRPIFKSLDYKFAIAGQKSASMESNSSVTYQRFAIMGKVEATDADGDKIAYRLKSPSNVV
IIVPQTGEIMLAGEPTSNELLIEVIAHDLRYPSLVSAKPAKVLLEFLAAEPVSFIMQHLE
HDDINNHSHHREKRRVTRAVRPTKRIEFTEADGDTEGKSVFQLEKETDKETFKIRDDNPW
VTVETNGAVRVKKKWDYEELGPEKTIDFWVIITNMGHNAGIKYTDNQRVIILVKDVNDEP
PYFINRPLPMQAVVQLNAPPNTPVFTLQARDPDTDHNIHYFIVRDRTGGRFEVDERSGVV
RTRGTDLFQLDMEYVLYVKAEDQNGKVDDRRFQSTPEERLSIVGGKRAPQFYMPSYEAEI
PENQKKDSDIISIKAKSFADREIRYTLKAQGQGAGTFNIGPTSGIVKLAKELDFEDLRQP
HVYSLIVTATEDSGGFSTSVDLTIRVTDVNDNAPKFELPDYQAHNVDEDIPLGTSILRVK
AMDSDSGSNAEIEYLVSDDHFAVDSNGIIVNNKQLDADNNNAYYEFIVTAKDKGEPPKSG
VATVRVYTKNKNDEEPKFSQQVYTPNVDENAGPNTLVTTVVASDKDGDNVRFGFVGGGTS
SGQFVIEDITGVIRLHNKAISLDKDKYELNVTAMDDGSCCVNGDQTIHTSTAVVVVFITD
VNDNKPVFKDCSTYYPKVEEGAPNGSPVIKVVATDEDKGVNGQVKYSIVQQPNQKGTKFT
VDEETGEVSTNKVFDREGDDGKFVSVTVKATDQGDPSLEGVCSFTVEITDVNDNPPLFDR
QKYVENVKQDASIGTNILRVSASDEDADNNGAIVYSLTAPFNPNDLEYFEIQAESGWIVL
KKPLDGCYPRDRYRLRVSASDKGTPASAADVDVELDVVDRNNKPPIWDKSIYGPIHIREN
VTVGTVVTSVKASSGIEGNPTVFYRLMPGSTAQTNKFHTFYLQQRPDNGDTWADIKVNHP
LDYESIKEYNLTIRVENNGAQQLASEATVYIMLEDVNDEIPLFTEREQETVLEGEPIGTK
VTQVNAIDKDGTFPNNQVYYYIVDSPRNEGKEFFEINLQSGEIFTKTVFDREKKGAYALE
VEARDGAPSARPNSNGPNSVTKFIRIGIADKNDNPPYFDKSLYEAEVDENEDIQHTVLTV
TAKDHDESSRIRYEITSGNIGGAFAVKNMTGAIYVAGALDYETRRRYELRLAASDNLKEN
YTTVIIHVKDVNDNPPVFERPTYRTQITEEDDRNLPKRVLQVTATDGDKDRPQNIVYFLT
GQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADV
QVNLKDINDNAPIFPQGVYFGNVTENGTAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNV
IEEETGSPIFEIEPDTGVIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIRVKDIN
DMPPQFTKDEWFTEVDETDGTALPEMPILTVTVHDEDETNKFQYKVIDNSGYGADKFTMV
RNNDGTGSLKIVQPLDYEDQLQSNGFRFRIQVNDKGEDNDNDKYHVAYSWVVVKLRDIND
NKPHFERANVEVSVFEDTKVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAINQNG
SVTIQRSLDREVVPRHQVKILAIDDGSPPKTATATLTVIVQDINDNAPKFLKDYRPVLPE
HVPPRKVVEILATDDDDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDGMAVIS
SLRSFDREQQKEYMIPIVIKDHGSPAMTGTSTLTVIIGDVNDNKMQPGSKDIFVYNYQGQ
SPDTPIGRVYVYDLDDWDLPDKKFYWEAMEHPRFKLDEDSGMVTMRAGTREGRYHLRFKV
YDRKHTQTDIPANVTVTVREIPHEAVVNSGSVRLSGISDEDFIRVWNYRTQSMSRSKMDR
FRDKLADLLNTERENVDIFSVQLKRKHPPLTDVRFSAHGSPYYKPVRLNGIVLMHREEIE
KDVGINITMVGIDECLYENQMCEGSCTNSLEISPLPYMVNANKTALVGVRVDTIADCTCG
ARNFTKPESCRTTPCHNGGRCVDTRFGPHCSCPVGYTGPRCQQTTRSFRGNGWAWYPPLE
MCDESHLSLEFITRKPDGLIIYNGPIVPPERDETLISDFIALELERGYPRLLIDFGSGTL
ELRVKTKKTLDDGEWHRIDLFWDTESIRMVVDFCKSAEIAEMEDGTPPEFDDMSCQARGQ
IPPFNEYLNVNAPLQVGGLYREQFDQSLYFWHYMPTAKGFDGCIRNLVHNSKLYDLAHPG
LSRNSVAGCPQTEEVCAQTETTARCWEHGNCVGSLSEARCHCRPGWTGPACNIPTIPTTF
KAQSYVKYALSFEPDRFSTQVQLRFRTREEYGELFRVSDQHNREYGILEIKDGHLHFRYN
LNSLRTEEKDLWLNAIVVNDGQWHVVKVNRYGSAATLELDGGEGRRYNETFEFVGHQWLL
VDKQEGVYAGGKAEYTGVRTFEVYADYQKSCLDDIRLEGKHLPLPPAMNGTQWGQATMAR
NLEKGCPSNKPCSNVICPDPFECVDLWNVYECTCPAGYKSSGSTCVNDNECLLFPCRNGG
RCRDHHPPKKYECHCPMGFTGMHCELELLASGVLTPSRDFIVALALCLGTLILLVLVFVV
YNRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPMPPELAPMKM
PIMYPVMTLMPGQEPNVGMFIEEHKKRADGDPNAPPFDDLRNYAYEGGGSTAGSLSSLAS
GTDDEQQEYDYLGAWGPRFDKLANMYGPEAPNPHNTELEL
Download sequence
Identical sequences Q4ABE8
FBpp0099720 FBpp0099720 NP_001027278.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]