SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099808 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099808
Domain Number 1 Region: 962-1238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-68
Family Tandem AAA-ATPase domain 0.0000413
Further Details:      
 
Domain Number 2 Region: 717-960
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.85e-54
Family Tandem AAA-ATPase domain 0.0000598
Further Details:      
 
Domain Number 3 Region: 453-565
Classification Level Classification E-value
Superfamily Chromo domain-like 2.33e-18
Family Chromo domain 0.021
Further Details:      
 
Domain Number 4 Region: 593-664
Classification Level Classification E-value
Superfamily Chromo domain-like 8.05e-16
Family Chromo domain 0.0027
Further Details:      
 
Domain Number 5 Region: 358-423
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000128
Family PHD domain 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0099808
Domain Number - Region: 149-187
Classification Level Classification E-value
Superfamily HMG-box 0.0524
Family HMG-box 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099808   Gene: FBgn0013591   Transcript: FBtr0100394
Sequence length 1983
Comment type=protein; loc=3L:complement(19875549..19875688,19875754..19881204,19881332..19881578,19881638..19881714,19903143..19903179); ID=FBpp0099808; name=Mi-2-PB; parent=FBgn0013591,FBtr0100394; dbxref=FlyBase_Annotation_IDs:CG8103-PB,FlyBase:FBpp0099808,GB_protein:AAX52739.1,REFSEQ:NP_001014591,GB_protein:AAX52739,FlyMine:FBpp0099808,modMine:FBpp0099808; MD5=6b0819ba56cad0c9be6428d9336d3d0b; length=1983; release=r5.30; species=Dmel;
Sequence
MASEEENDDNFQEEEEAQEDNAPAAELSNDSDAPLKPNQNDEDDDYDPEDSRRKKKGKKR
KTRKGEEKGRKKKKRKKNESEEDSDFVQHDEEVEYPSTSKRGRKRKEEKQAAKEKESASS
GMPSVEDVCSAFSVCNVEIEYSEEELQSLTTYKAFMHHVRPILQKENPKIAAPKLVMLVA
AKWREFCESNPHIQQEGGAAGSGGSAGQARSVTGDEPEEPRSSRSSRNEKPDDIYEEAVE
EEEEEEEEEKKPRRKRSGRGKKGRRPSGKVPTLKIKLLGKRKRDSSDEEQDASGASERDS
DLEFERMLQKSDDSADEKEAPVSSKADNSAPAAQDDGSGAPVVRKKAKTKIGNKFKKKNK
LKKTKNFPEGEDGEHEHQDYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCP
HCEADGGAAEEEDDDEHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCP
RCSCPPLTGKAEKIITWRWAQRSNDDGPSTSKGSKNSNSRVREYFIKWHNMSYWHCEWVP
EVQLDVHHPLMIRSFQRKYDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEVLE
ERFYKNGVKPEWLIVQRVINHRTARDGSTMYLVKWRELPYDKSTWEEEGDDIQGLRQAID
YYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQ
PAFLEGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCR
GPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSKVSR
LRTTQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYK
LLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGPHMLRR
LKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKK
CCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTK
MLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLAT
ADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHL
VVRPGMGGKGANFTKQELDDILRFGTEDLFKEDDKEEAIHYDDKAVAELLDRTNRGIEEK
ESWANEYLSSFKVASYATKEEEEEEETEIIKQDAENSDPAYWVKLLRHHYEQHQEDVGRS
LGKGKRVRKQVNYTDGGVVAADTTRDDSNWQDNGSEYNSEYSAGSDEDGGDDDFDDQNGA
ERKAKRRLERRDDRPLPPLLARVGGNIEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQWL
VRDLRGKSERNFKAYVSLFMRHLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRK
KVQEFEHINGYYSMPELILKPCEPVRSALKQDVAALEAPPTGGNVDKSATTSNSVTPATS
AAPSPAPASEKGEDKDKDSEKEKDKTSAEKSEVKQEQEAEEDKKPGDVKQENPVEEAAGD
TKPSDAEVKTEVAKTEPKEETKDPEVKEEPKTEEKEKEKVDDKKPIPPTTVIDDDDDDVM
IVKEDGELEKPSASSPKDQKAVAAATSAATGATGKGAEDSLEVLKRKFMFNIADGGFTEL
HTLWLNEEKAAVPGREYEIWHRRHDYWLLAGIVTHGYGRWQDIQNDIRFAIINEPFKMDV
GKGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNLAQDPSHPAMSLNARFAEVECLA
ESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKSDVSRLPATLARIPPVAQRLQMSE
RSILSRLAATAGNASNAAQLMAQFPAGFQGTTLPAFTSGPAGNFANFRPQFSVPGQLSNN
SGV
Download sequence
Identical sequences Q59E34
FBpp0099808 NP_001014591.1.81976 FBpp0099808 7227.FBpp0099808 FBpp0099808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]