SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099826 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099826
Domain Number 1 Region: 296-301,355-746
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.14e-98
Family Formin homology 2 domain (FH2 domain) 0.00000828
Further Details:      
 
Domain Number 2 Region: 1-229
Classification Level Classification E-value
Superfamily ARM repeat 4.76e-47
Family Diap1 N-terninal region-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099826   Gene: FBgn0053556   Transcript: FBtr0091533
Sequence length 1644
Comment type=protein; loc=3L:join(7104385..7104567,7104727..7104901,7108317..7108350,7111033..7111180,7111356..7112374,7112436..7112786,7112848..7113227,7113283..7113850,7113919..7114052,7114115..7116057); ID=FBpp0099826; name=form3-PA; parent=FBgn0053556,FBtr0091533; dbxref=FlyBase_Annotation_IDs:CG33556-PA,FlyBase:FBpp0099826,GB_protein:AAX52757.1,REFSEQ:NP_001014571,GB_protein:AAX52757,FlyMine:FBpp0099826,modMine:FBpp0099826; MD5=63aeecd4f930cd5c7f3d1cdd4358e979; length=1644; release=r5.30; species=Dmel;
Sequence
MDSRIGLDYIVENRDYIAKLGAALDTQNATVKKQVFELLSALCAYSPDGYARAIETLEFY
KNLKKQRYRFKIVINELELSSAAAHPPLDYQAALLAFINCVIISAATLQERIRIRNEFIG
LKVLPLLNNLRKVAQSVGDIIVQLDVFVEQQECDEAQSLQAPDGINLNSHLDVFYAILRQ
VADTPQEVPFLNILQHLLRIDPKEPLSDIIWDTTERLVHRATLLESHEDSVRLLRTPSSQ
KFACQSCRGSDASSPTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPP
PMINGGALPPPPPPPSMQMASRPRTPDPLAAEAVATAILLPQQDTPAPKAKMKTINWGKI
PHNKVLGKQNIWSIVASNHQDSPMQDIDWNEMEGLFCLQTASAQGSPKLGRDGSQAAAGS
NGCDTLDRKSKKESTEITLLDGKRSLNVNIFLKQFRTSNDDIIQLIRQGAHEEIGAERLR
GLLKIMPEVDELDMLKGFNGDKARLGNAEKFLLQLLEVPNYKLRIESMLLKEEFAANVAY
LEPCINSMLYAGDDLLNNKTLQEVLYMVVVAGNFLNSGGYAGNAAGVKLSSLQKLTDIRA
NKPGMNLIHFVALQAEKRNPELLQFTGQLSNLESASKTTSEQINNEINTLDGRIRRIARQ
IEQPATDVDIKEQMADFLQAAESELSVLQAGMKQVESMRLKMSEFFCDDAATFRLEECFK
IFHNFCDKFKQAVKENERRQQQEQQATLRRKQREEQLARRARQIGQAGTPVSDSEHSFLG
DAIFDPRASPALSRRHLGSGEISNGFIRLEQDGASPDITPNGSLRRRRSRVLAEEDDLME
FLRSSTGPHHDGHNSRERKAAYGSLDRSWARRARSGSSSRKRPDLLNIDFGMDRERASSP
APLLQQQQQNVQERLQSPLASTAGTPTTAANTPTGSGSAIAQTPSNNEDAKPRISREWRQ
KIETWLQSNESDEKQNEEYRRKRRLVNANRRSLENETENERKLDPLPEEKILPSTTTATP
TNTPTTTNPTNSTNRMDQESGKYQRVYADWKPSRTLEQTDVVANLQAIADAQPHDALRQH
RRQRSQEQPSPIALQSIAEEDRRKSLIQKQGERDKSNERLQIYIRRSSSRELQPAKTEEH
PLPPKSPKPQVSDDTFASLLSHHKTQNEMQGSSKDVDADNIETPPVSRRVIATPTTTVVT
VSMTDKPKAATEEKINPAEQDAPGHFDRHALARRTRRYKRPTDYSSGNEEALTTSTAEAK
TSPSKPEPPAPEKSKQKERTINKLEKVGRHISSINQEDVREAIRNLKSPTGTPERPWSPP
RDITPSKLKLSASGHHELNDEGFEETQSLVSDTPSHGKGESTNSSCNEGVNETPARQRPM
QKQKPTTTSISQMGSRLADRLQQARMKSSGSSGSAASKSQNQIPATQTATVKRSLSASRP
LRMPNGQPLASAAPLRSASTVRRSPQEQQVLAGVERSSSRNSLRSSRSSINSGASTQTVV
RRLPAVQRAGATVSVDSSPSKRPLAAQNLRPTQGRGVPASRSSSSGSSVGPSVILVRSKM
SNTAPKSSIHGSTSFKENQSQSQPQSQSRMSAARSVVLVKNALNQQQQARMSANPSPQQR
STSSSRSVSSFMRPTASSATKRQK
Download sequence
Identical sequences Q86C16
FBpp0099826 FBpp0099826 NP_001014571.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]